Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BHD9

Protein Details
Accession A0A2H3BHD9   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-70NVYPPHGRRRHTRRAHKTRLAAABasic
NLS Segment(s)
PositionSequence
54-77GRRRHTRRAHKTRLAAAFQRLRRK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MAMSNYPFRHSTYYTRDDDEFISELPPMSSEEDVLQELQNYERQATPNVYPPHGRRRHTRRAHKTRLAAAFQRLRRKLQNGIKVIATALRGTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.44
4 0.41
5 0.38
6 0.33
7 0.26
8 0.19
9 0.17
10 0.13
11 0.13
12 0.11
13 0.11
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.1
20 0.11
21 0.11
22 0.09
23 0.08
24 0.08
25 0.09
26 0.11
27 0.1
28 0.1
29 0.11
30 0.12
31 0.13
32 0.15
33 0.15
34 0.21
35 0.22
36 0.23
37 0.25
38 0.28
39 0.37
40 0.41
41 0.43
42 0.45
43 0.53
44 0.62
45 0.69
46 0.77
47 0.78
48 0.82
49 0.89
50 0.86
51 0.83
52 0.8
53 0.76
54 0.7
55 0.62
56 0.59
57 0.57
58 0.55
59 0.6
60 0.55
61 0.54
62 0.56
63 0.57
64 0.59
65 0.6
66 0.64
67 0.59
68 0.58
69 0.54
70 0.47
71 0.43
72 0.35
73 0.27