Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K2I5

Protein Details
Accession B6K2I5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
176-195ASSREKSKGKGKKPIQPEDMHydrophilic
NLS Segment(s)
PositionSequence
179-188REKSKGKGKK
Subcellular Location(s) mito 16.5, cyto_mito 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002778  Signal_recog_particle_SRP19  
IPR036521  SRP19-like_sf  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF01922  SRP19  
Amino Acid Sequences MVVLYPIYFDRTRPKGLRRVPKELAIENPLAKNIGDVVYKLGYKCVLNPSKTHPADWANPGRVDVVLPDNMNRRSLYKQVAQQLVLNPTKREDPLRLPVSGLPAKLPEQPPAYPKGMKGNTILPLHSPAVSGGGVSDNMLQDMMQAFQNPGNGGNPLLSLGAPSPASNASSSSPPASSREKSKGKGKKPIQPEDMVMDLDLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.64
4 0.73
5 0.72
6 0.76
7 0.72
8 0.72
9 0.7
10 0.63
11 0.58
12 0.52
13 0.47
14 0.41
15 0.37
16 0.31
17 0.26
18 0.23
19 0.18
20 0.14
21 0.14
22 0.11
23 0.11
24 0.13
25 0.14
26 0.16
27 0.16
28 0.15
29 0.15
30 0.15
31 0.18
32 0.25
33 0.29
34 0.3
35 0.32
36 0.38
37 0.47
38 0.47
39 0.45
40 0.39
41 0.37
42 0.4
43 0.45
44 0.44
45 0.37
46 0.36
47 0.36
48 0.32
49 0.27
50 0.23
51 0.17
52 0.13
53 0.11
54 0.11
55 0.13
56 0.18
57 0.19
58 0.21
59 0.2
60 0.2
61 0.21
62 0.25
63 0.27
64 0.26
65 0.31
66 0.36
67 0.37
68 0.35
69 0.34
70 0.33
71 0.35
72 0.33
73 0.3
74 0.23
75 0.22
76 0.23
77 0.22
78 0.22
79 0.19
80 0.2
81 0.27
82 0.29
83 0.28
84 0.27
85 0.27
86 0.29
87 0.27
88 0.23
89 0.15
90 0.14
91 0.15
92 0.19
93 0.19
94 0.17
95 0.19
96 0.2
97 0.22
98 0.25
99 0.26
100 0.23
101 0.22
102 0.28
103 0.27
104 0.27
105 0.27
106 0.26
107 0.29
108 0.29
109 0.28
110 0.2
111 0.22
112 0.21
113 0.19
114 0.16
115 0.1
116 0.11
117 0.1
118 0.09
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.07
131 0.06
132 0.07
133 0.07
134 0.09
135 0.1
136 0.1
137 0.11
138 0.11
139 0.11
140 0.1
141 0.1
142 0.09
143 0.08
144 0.08
145 0.07
146 0.07
147 0.06
148 0.08
149 0.08
150 0.08
151 0.09
152 0.1
153 0.11
154 0.11
155 0.12
156 0.12
157 0.14
158 0.17
159 0.17
160 0.17
161 0.18
162 0.22
163 0.27
164 0.29
165 0.34
166 0.42
167 0.48
168 0.53
169 0.62
170 0.67
171 0.7
172 0.76
173 0.77
174 0.76
175 0.79
176 0.83
177 0.79
178 0.73
179 0.67
180 0.61
181 0.55
182 0.46