Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3B1D9

Protein Details
Accession A0A2H3B1D9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPPKRAATKKKSAASKAKNPPEPKKAPAHydrophilic
NLS Segment(s)
PositionSequence
3-32PKRAATKKKSAASKAKNPPEPKKAPAKRAR
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MPPKRAATKKKSAASKAKNPPEPKKAPAKRARASNVESDASSEESEPEVLAKRVKTDQKTTTTQATNVVVEKADFAGKFDLYNMSLDYLRRLGNDYEALYDAILGRQEKSEFSAQVAIPKAPYFTEDGAAKDPAFCIEDMDMPPFPLRLKYIRSVDAVGYTDEELDFFPEGDDDSSSVRASAPGLMADLKLAGRNPSARCCSGKFLMHRSWTQTKRDGSIVELFEGYFDVSLSYGQMKYDDHACSVDSVFGFWAVRARKDEDGKEIGIELDSEDGGCCIGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.84
5 0.85
6 0.85
7 0.85
8 0.84
9 0.8
10 0.77
11 0.77
12 0.76
13 0.78
14 0.79
15 0.8
16 0.76
17 0.8
18 0.79
19 0.76
20 0.71
21 0.67
22 0.62
23 0.54
24 0.47
25 0.39
26 0.34
27 0.28
28 0.25
29 0.18
30 0.14
31 0.13
32 0.13
33 0.11
34 0.11
35 0.11
36 0.12
37 0.15
38 0.15
39 0.18
40 0.25
41 0.33
42 0.37
43 0.42
44 0.48
45 0.51
46 0.56
47 0.56
48 0.56
49 0.51
50 0.46
51 0.43
52 0.37
53 0.32
54 0.28
55 0.25
56 0.17
57 0.15
58 0.15
59 0.11
60 0.12
61 0.1
62 0.11
63 0.12
64 0.12
65 0.12
66 0.12
67 0.13
68 0.11
69 0.12
70 0.11
71 0.1
72 0.11
73 0.12
74 0.13
75 0.13
76 0.12
77 0.12
78 0.15
79 0.14
80 0.15
81 0.17
82 0.15
83 0.14
84 0.15
85 0.14
86 0.11
87 0.11
88 0.09
89 0.07
90 0.09
91 0.08
92 0.07
93 0.09
94 0.09
95 0.09
96 0.13
97 0.15
98 0.13
99 0.14
100 0.18
101 0.16
102 0.2
103 0.21
104 0.18
105 0.16
106 0.15
107 0.15
108 0.1
109 0.11
110 0.1
111 0.09
112 0.11
113 0.12
114 0.13
115 0.14
116 0.15
117 0.14
118 0.11
119 0.11
120 0.09
121 0.09
122 0.08
123 0.07
124 0.07
125 0.08
126 0.09
127 0.11
128 0.1
129 0.09
130 0.1
131 0.09
132 0.09
133 0.08
134 0.09
135 0.11
136 0.14
137 0.19
138 0.21
139 0.23
140 0.24
141 0.25
142 0.23
143 0.22
144 0.2
145 0.14
146 0.12
147 0.1
148 0.09
149 0.07
150 0.08
151 0.06
152 0.06
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.06
159 0.06
160 0.05
161 0.06
162 0.07
163 0.07
164 0.07
165 0.07
166 0.07
167 0.07
168 0.08
169 0.07
170 0.06
171 0.07
172 0.07
173 0.07
174 0.07
175 0.07
176 0.06
177 0.07
178 0.07
179 0.08
180 0.09
181 0.15
182 0.17
183 0.23
184 0.27
185 0.29
186 0.31
187 0.33
188 0.36
189 0.36
190 0.39
191 0.37
192 0.4
193 0.44
194 0.45
195 0.45
196 0.47
197 0.52
198 0.52
199 0.53
200 0.53
201 0.49
202 0.48
203 0.48
204 0.42
205 0.36
206 0.37
207 0.32
208 0.26
209 0.23
210 0.2
211 0.17
212 0.17
213 0.13
214 0.07
215 0.06
216 0.05
217 0.05
218 0.05
219 0.06
220 0.08
221 0.08
222 0.08
223 0.1
224 0.1
225 0.12
226 0.17
227 0.18
228 0.17
229 0.17
230 0.17
231 0.18
232 0.18
233 0.18
234 0.13
235 0.13
236 0.12
237 0.12
238 0.12
239 0.1
240 0.16
241 0.16
242 0.2
243 0.24
244 0.28
245 0.34
246 0.4
247 0.43
248 0.43
249 0.45
250 0.42
251 0.39
252 0.35
253 0.28
254 0.22
255 0.19
256 0.12
257 0.09
258 0.09
259 0.08
260 0.08
261 0.07