Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K095

Protein Details
Accession B6K095    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-39KVKSQCPKVEKQEKPKQPKGRAYKRLLHydrophilic
NLS Segment(s)
PositionSequence
25-34EKPKQPKGRA
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEKQEKPKQPKGRAYKRLLYVRRFVNVTNMVGGKRRMNPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.48
4 0.49
5 0.52
6 0.59
7 0.63
8 0.68
9 0.69
10 0.71
11 0.74
12 0.77
13 0.81
14 0.83
15 0.82
16 0.79
17 0.81
18 0.81
19 0.81
20 0.81
21 0.78
22 0.75
23 0.74
24 0.75
25 0.72
26 0.66
27 0.62
28 0.55
29 0.53
30 0.47
31 0.4
32 0.38
33 0.35
34 0.32
35 0.29
36 0.27
37 0.25
38 0.27
39 0.3
40 0.28
41 0.32