Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CFZ2

Protein Details
Accession A0A2H3CFZ2    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
71-101LQERRDERERRKQLERKREQKRQERVLERSGBasic
NLS Segment(s)
PositionSequence
74-92RRDERERRKQLERKREQKR
Subcellular Location(s) mito 18.5, cyto_mito 10, nucl 8
Family & Domain DBs
Amino Acid Sequences MSIIALARLSRPLRTSHTRSFSGIAITQDLKSAHNRETTRVHHFYETQLSKLRQELKSLQRAKIKWERQDLQERRDERERRKQLERKREQKRQERVLERSGVEAQLMVWVPTIWNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.46
3 0.48
4 0.53
5 0.53
6 0.53
7 0.51
8 0.45
9 0.39
10 0.34
11 0.26
12 0.22
13 0.21
14 0.19
15 0.19
16 0.19
17 0.17
18 0.2
19 0.21
20 0.21
21 0.27
22 0.28
23 0.29
24 0.35
25 0.38
26 0.41
27 0.42
28 0.41
29 0.36
30 0.36
31 0.34
32 0.36
33 0.33
34 0.27
35 0.29
36 0.28
37 0.27
38 0.3
39 0.34
40 0.26
41 0.29
42 0.34
43 0.35
44 0.44
45 0.46
46 0.47
47 0.46
48 0.45
49 0.49
50 0.51
51 0.51
52 0.48
53 0.53
54 0.52
55 0.52
56 0.63
57 0.6
58 0.55
59 0.56
60 0.51
61 0.49
62 0.55
63 0.56
64 0.53
65 0.6
66 0.64
67 0.64
68 0.73
69 0.76
70 0.76
71 0.81
72 0.83
73 0.82
74 0.84
75 0.87
76 0.87
77 0.89
78 0.89
79 0.88
80 0.87
81 0.85
82 0.8
83 0.77
84 0.72
85 0.62
86 0.56
87 0.48
88 0.38
89 0.29
90 0.23
91 0.17
92 0.16
93 0.15
94 0.12
95 0.1
96 0.1