Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JVJ7

Protein Details
Accession B6JVJ7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
144-167VSLYKLLKKLNKKDKDGKKIDSKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 12.833, mito_nucl 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR039999  LYAR  
IPR014898  Znf_C2H2_LYAR  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF08790  zf-LYAR  
PROSITE View protein in PROSITE  
PS51804  ZF_C2HC_LYAR  
Amino Acid Sequences MVSFSCEVCADIVKKPKLDQHVSRCRGAYFTCIDCNTTFQGTEYRAHSSCMTEAQRYQKSLYRPTKKEAKKLAAQKQQETGTTNSNTQKRKAESEKENSAPASEKESKKSKKDDDSNKTDKPEKSSKDSKLSSRFAELCSESDVSLYKLLKKLNKKDKDGKKIDSKTVLEQLVAKKDSKGQLVISFAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.43
4 0.47
5 0.54
6 0.57
7 0.58
8 0.65
9 0.68
10 0.68
11 0.63
12 0.55
13 0.49
14 0.41
15 0.35
16 0.28
17 0.27
18 0.28
19 0.28
20 0.29
21 0.27
22 0.28
23 0.26
24 0.23
25 0.2
26 0.16
27 0.19
28 0.19
29 0.22
30 0.21
31 0.24
32 0.23
33 0.25
34 0.24
35 0.22
36 0.21
37 0.24
38 0.24
39 0.21
40 0.25
41 0.31
42 0.34
43 0.34
44 0.36
45 0.34
46 0.36
47 0.44
48 0.51
49 0.52
50 0.52
51 0.56
52 0.64
53 0.65
54 0.69
55 0.67
56 0.63
57 0.61
58 0.67
59 0.71
60 0.69
61 0.67
62 0.61
63 0.57
64 0.52
65 0.46
66 0.39
67 0.31
68 0.28
69 0.26
70 0.27
71 0.27
72 0.32
73 0.32
74 0.33
75 0.36
76 0.34
77 0.39
78 0.42
79 0.45
80 0.46
81 0.51
82 0.53
83 0.49
84 0.47
85 0.4
86 0.35
87 0.28
88 0.22
89 0.22
90 0.24
91 0.24
92 0.28
93 0.37
94 0.42
95 0.46
96 0.53
97 0.53
98 0.55
99 0.63
100 0.69
101 0.68
102 0.72
103 0.73
104 0.69
105 0.66
106 0.64
107 0.56
108 0.52
109 0.52
110 0.48
111 0.49
112 0.54
113 0.55
114 0.57
115 0.59
116 0.6
117 0.59
118 0.58
119 0.52
120 0.5
121 0.45
122 0.38
123 0.38
124 0.32
125 0.25
126 0.25
127 0.24
128 0.18
129 0.17
130 0.16
131 0.13
132 0.16
133 0.16
134 0.16
135 0.19
136 0.24
137 0.31
138 0.4
139 0.49
140 0.56
141 0.64
142 0.69
143 0.76
144 0.82
145 0.85
146 0.84
147 0.82
148 0.82
149 0.79
150 0.77
151 0.75
152 0.67
153 0.62
154 0.61
155 0.53
156 0.43
157 0.42
158 0.4
159 0.4
160 0.39
161 0.34
162 0.3
163 0.35
164 0.39
165 0.38
166 0.36
167 0.31
168 0.33