Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0S2X2

Protein Details
Accession T0S2X2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24ISSSNESERAQRRRRNACFRCGQVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences ISSSNESERAQRRRRNACFRCGQVGHYSRICPHRRRPQAGNVPIQYVCLPMPMPGYPSFGYGAYPSAPAPAPAAFPAAFPMMGQNPGANLDSHSNRSGNNYYSPCGPGFRPPSPPELEKPMFCGSLVSSPITESPTVRLVLKLRIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.82
4 0.81
5 0.8
6 0.78
7 0.77
8 0.67
9 0.6
10 0.58
11 0.55
12 0.51
13 0.45
14 0.41
15 0.37
16 0.46
17 0.5
18 0.48
19 0.54
20 0.6
21 0.67
22 0.73
23 0.73
24 0.75
25 0.78
26 0.77
27 0.75
28 0.66
29 0.59
30 0.51
31 0.47
32 0.36
33 0.26
34 0.19
35 0.12
36 0.11
37 0.08
38 0.1
39 0.09
40 0.12
41 0.11
42 0.15
43 0.14
44 0.15
45 0.15
46 0.14
47 0.14
48 0.11
49 0.12
50 0.08
51 0.09
52 0.07
53 0.08
54 0.08
55 0.07
56 0.08
57 0.08
58 0.07
59 0.07
60 0.09
61 0.07
62 0.07
63 0.08
64 0.08
65 0.07
66 0.07
67 0.08
68 0.07
69 0.08
70 0.08
71 0.06
72 0.06
73 0.08
74 0.09
75 0.07
76 0.08
77 0.11
78 0.13
79 0.16
80 0.18
81 0.17
82 0.16
83 0.21
84 0.23
85 0.21
86 0.26
87 0.25
88 0.25
89 0.26
90 0.28
91 0.24
92 0.23
93 0.22
94 0.23
95 0.28
96 0.3
97 0.35
98 0.35
99 0.4
100 0.43
101 0.45
102 0.41
103 0.43
104 0.44
105 0.37
106 0.4
107 0.38
108 0.33
109 0.3
110 0.27
111 0.19
112 0.21
113 0.23
114 0.19
115 0.16
116 0.16
117 0.18
118 0.19
119 0.18
120 0.14
121 0.16
122 0.18
123 0.19
124 0.19
125 0.22
126 0.22