Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CQ47

Protein Details
Accession A0A2H3CQ47   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MDTTSKHHKRSREPRGLSQPSFHydrophilic
283-319PLRKPPPSSDEDKKPPRRRRTAKPRRSSSRRSVVKGEBasic
NLS Segment(s)
PositionSequence
285-314RKPPPSSDEDKKPPRRRRTAKPRRSSSRRS
Subcellular Location(s) plas 19, nucl 3, E.R. 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009617  Seipin  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0140042  P:lipid droplet formation  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF06775  Seipin  
Amino Acid Sequences MDTTSKHHKRSREPRGLSQPSFASASIQYLLSLLSKSLKPFAPQIIPLAVFIFLIPLALCLSGLAGWIVWKNVAVSWETPLFLQYGDGLAPYAESSLPQLVSQQPYDVLLHLVVPATESNLALGNFMASLRLSSDSNQTLAVVRRPAIVLPSRAFFFSGKPSTFNIDIPLLHSYTFGTPYANAYVQIGRQDGWRTLGSGEGRELAVSNAHLRGILVHRGIRGLVTRFPLISAMISSMIFLVTLLAMVSLCILPTMLSEPIGKSYLDDDDDDDVGSEPFDDEKPLRKPPPSSDEDKKPPRRRRTAKPRRSSSRRSVVKGEHSDQPIPSGSGSGESSGFLRRRRSRLSDGLSDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.88
4 0.79
5 0.73
6 0.63
7 0.55
8 0.5
9 0.39
10 0.31
11 0.22
12 0.23
13 0.19
14 0.17
15 0.14
16 0.12
17 0.13
18 0.11
19 0.11
20 0.09
21 0.12
22 0.14
23 0.16
24 0.21
25 0.23
26 0.24
27 0.28
28 0.34
29 0.34
30 0.33
31 0.34
32 0.33
33 0.31
34 0.29
35 0.26
36 0.19
37 0.15
38 0.13
39 0.1
40 0.06
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.06
55 0.07
56 0.06
57 0.07
58 0.07
59 0.08
60 0.1
61 0.1
62 0.11
63 0.13
64 0.15
65 0.14
66 0.14
67 0.13
68 0.13
69 0.11
70 0.1
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.08
84 0.08
85 0.08
86 0.11
87 0.14
88 0.16
89 0.17
90 0.16
91 0.14
92 0.15
93 0.16
94 0.14
95 0.11
96 0.08
97 0.08
98 0.08
99 0.08
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.08
108 0.08
109 0.08
110 0.07
111 0.06
112 0.06
113 0.06
114 0.06
115 0.04
116 0.04
117 0.05
118 0.07
119 0.07
120 0.08
121 0.13
122 0.13
123 0.14
124 0.14
125 0.13
126 0.14
127 0.15
128 0.17
129 0.14
130 0.13
131 0.13
132 0.14
133 0.13
134 0.14
135 0.16
136 0.16
137 0.16
138 0.17
139 0.17
140 0.16
141 0.17
142 0.14
143 0.13
144 0.16
145 0.19
146 0.19
147 0.2
148 0.21
149 0.23
150 0.24
151 0.22
152 0.18
153 0.15
154 0.15
155 0.14
156 0.15
157 0.11
158 0.1
159 0.1
160 0.09
161 0.08
162 0.1
163 0.08
164 0.07
165 0.07
166 0.08
167 0.1
168 0.09
169 0.09
170 0.08
171 0.09
172 0.09
173 0.11
174 0.1
175 0.08
176 0.1
177 0.11
178 0.11
179 0.13
180 0.13
181 0.12
182 0.12
183 0.15
184 0.14
185 0.13
186 0.13
187 0.11
188 0.1
189 0.09
190 0.1
191 0.06
192 0.06
193 0.06
194 0.07
195 0.07
196 0.07
197 0.07
198 0.06
199 0.08
200 0.1
201 0.13
202 0.13
203 0.14
204 0.14
205 0.14
206 0.15
207 0.13
208 0.14
209 0.13
210 0.14
211 0.15
212 0.16
213 0.15
214 0.15
215 0.15
216 0.13
217 0.11
218 0.08
219 0.07
220 0.07
221 0.07
222 0.07
223 0.06
224 0.06
225 0.05
226 0.05
227 0.04
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.04
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.04
241 0.07
242 0.06
243 0.08
244 0.09
245 0.09
246 0.12
247 0.13
248 0.12
249 0.11
250 0.12
251 0.13
252 0.14
253 0.14
254 0.13
255 0.14
256 0.15
257 0.14
258 0.13
259 0.11
260 0.1
261 0.09
262 0.07
263 0.06
264 0.07
265 0.07
266 0.1
267 0.11
268 0.18
269 0.23
270 0.31
271 0.36
272 0.4
273 0.44
274 0.49
275 0.56
276 0.55
277 0.58
278 0.58
279 0.63
280 0.69
281 0.75
282 0.78
283 0.8
284 0.85
285 0.88
286 0.9
287 0.9
288 0.91
289 0.91
290 0.92
291 0.92
292 0.93
293 0.93
294 0.93
295 0.93
296 0.91
297 0.9
298 0.89
299 0.87
300 0.81
301 0.79
302 0.75
303 0.76
304 0.74
305 0.68
306 0.64
307 0.61
308 0.58
309 0.51
310 0.46
311 0.38
312 0.31
313 0.27
314 0.21
315 0.16
316 0.16
317 0.16
318 0.14
319 0.13
320 0.12
321 0.13
322 0.2
323 0.24
324 0.26
325 0.36
326 0.43
327 0.5
328 0.58
329 0.65
330 0.67
331 0.72
332 0.75
333 0.74