Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3C2H7

Protein Details
Accession A0A2H3C2H7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MAVKIPIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-52KKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTPMPK
Subcellular Location(s) nucl 14.5, mito_nucl 13, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIPIVKKRTKPFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTPMPKIGYGSNKKTRHLLPNGLKKFLVSNVRELEILLMHNKSYAAEIAHNVSSRNRTTILERAKALGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.9
4 0.91
5 0.9
6 0.9
7 0.87
8 0.85
9 0.82
10 0.74
11 0.65
12 0.59
13 0.56
14 0.54
15 0.56
16 0.57
17 0.52
18 0.5
19 0.5
20 0.55
21 0.59
22 0.59
23 0.59
24 0.61
25 0.7
26 0.78
27 0.83
28 0.76
29 0.74
30 0.71
31 0.69
32 0.69
33 0.66
34 0.67
35 0.68
36 0.71
37 0.64
38 0.58
39 0.51
40 0.45
41 0.45
42 0.4
43 0.4
44 0.44
45 0.45
46 0.45
47 0.49
48 0.48
49 0.47
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.47
57 0.4
58 0.36
59 0.32
60 0.31
61 0.22
62 0.25
63 0.25
64 0.26
65 0.25
66 0.24
67 0.2
68 0.13
69 0.13
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.09
78 0.08
79 0.09
80 0.1
81 0.13
82 0.14
83 0.15
84 0.15
85 0.17
86 0.2
87 0.21
88 0.22
89 0.21
90 0.21
91 0.25
92 0.33
93 0.37
94 0.37
95 0.37
96 0.37
97 0.38
98 0.37
99 0.33
100 0.3
101 0.24
102 0.21
103 0.24
104 0.28
105 0.27
106 0.27
107 0.31
108 0.28