Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K3Y0

Protein Details
Accession B6K3Y0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-60YPAAKTRKYNWNPKAKRRKTTGHydrophilic
NLS Segment(s)
PositionSequence
49-82WNPKAKRRKTTGTGRMRHLKEVHMRFKNGFRAGK
Subcellular Location(s) mito 14, cyto 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCAACGYPAAKTRKYNWNPKAKRRKTTGTGRMRHLKEVHMRFKNGFRAGKPAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.58
3 0.6
4 0.58
5 0.63
6 0.68
7 0.71
8 0.69
9 0.74
10 0.71
11 0.69
12 0.73
13 0.75
14 0.75
15 0.76
16 0.71
17 0.68
18 0.66
19 0.58
20 0.48
21 0.38
22 0.29
23 0.2
24 0.22
25 0.18
26 0.15
27 0.2
28 0.23
29 0.26
30 0.29
31 0.32
32 0.39
33 0.45
34 0.52
35 0.54
36 0.61
37 0.66
38 0.74
39 0.81
40 0.78
41 0.8
42 0.77
43 0.77
44 0.74
45 0.77
46 0.77
47 0.76
48 0.74
49 0.73
50 0.76
51 0.69
52 0.67
53 0.58
54 0.55
55 0.55
56 0.58
57 0.61
58 0.57
59 0.58
60 0.55
61 0.6
62 0.62
63 0.6
64 0.56
65 0.47
66 0.5
67 0.5