Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K352

Protein Details
Accession B6K352    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
79-101AGHPCYRPRRTGERKRKSVRGCIBasic
182-209VTPRTLQHKRHRFALKRRQAEKNREAAAHydrophilic
NLS Segment(s)
PositionSequence
87-95RRTGERKRK
131-143KRLGPKRASKIRR
158-204IRREVQPKGEGKKPYTKAPKIQRLVTPRTLQHKRHRFALKRRQAEKN
223-239KQKKEIIKARRASSMRK
Subcellular Location(s) cyto 13.5, cyto_nucl 13, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014401  Ribosomal_S6_euk  
IPR001377  Ribosomal_S6e  
IPR018282  Ribosomal_S6e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01092  Ribosomal_S6e  
PROSITE View protein in PROSITE  
PS00578  RIBOSOMAL_S6E  
Amino Acid Sequences MKLNISYPANGTQKLIEIDDERRLRVFMEKRMGQEVPGDSVGPEFAGYVFKITGGNDKQGFPMMQGVLLPHRVRLLLRAGHPCYRPRRTGERKRKSVRGCIVGQDLAVLALSVVKQGEQDIPGLTDVTAPKRLGPKRASKIRRFFNLTKEDDVRKFVIRREVQPKGEGKKPYTKAPKIQRLVTPRTLQHKRHRFALKRRQAEKNREAAAEFAQLLAQRVAEQKQKKEIIKARRASSMRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.21
4 0.21
5 0.24
6 0.31
7 0.32
8 0.29
9 0.29
10 0.28
11 0.26
12 0.32
13 0.34
14 0.33
15 0.41
16 0.43
17 0.45
18 0.5
19 0.49
20 0.41
21 0.4
22 0.33
23 0.27
24 0.24
25 0.22
26 0.16
27 0.17
28 0.16
29 0.11
30 0.09
31 0.05
32 0.05
33 0.07
34 0.07
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.17
41 0.17
42 0.23
43 0.23
44 0.24
45 0.24
46 0.26
47 0.26
48 0.18
49 0.2
50 0.14
51 0.13
52 0.12
53 0.13
54 0.12
55 0.17
56 0.16
57 0.13
58 0.13
59 0.14
60 0.14
61 0.16
62 0.19
63 0.18
64 0.23
65 0.29
66 0.32
67 0.37
68 0.39
69 0.43
70 0.47
71 0.48
72 0.48
73 0.47
74 0.54
75 0.6
76 0.69
77 0.74
78 0.75
79 0.8
80 0.83
81 0.86
82 0.8
83 0.79
84 0.74
85 0.68
86 0.59
87 0.51
88 0.47
89 0.38
90 0.33
91 0.23
92 0.16
93 0.1
94 0.08
95 0.05
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.06
106 0.06
107 0.06
108 0.07
109 0.07
110 0.07
111 0.06
112 0.07
113 0.08
114 0.09
115 0.12
116 0.12
117 0.14
118 0.22
119 0.24
120 0.29
121 0.34
122 0.41
123 0.47
124 0.58
125 0.64
126 0.65
127 0.72
128 0.71
129 0.73
130 0.71
131 0.65
132 0.63
133 0.63
134 0.57
135 0.53
136 0.5
137 0.48
138 0.41
139 0.41
140 0.35
141 0.31
142 0.3
143 0.28
144 0.34
145 0.33
146 0.39
147 0.44
148 0.49
149 0.47
150 0.5
151 0.54
152 0.48
153 0.52
154 0.49
155 0.45
156 0.48
157 0.49
158 0.53
159 0.58
160 0.59
161 0.62
162 0.68
163 0.73
164 0.69
165 0.71
166 0.68
167 0.66
168 0.67
169 0.64
170 0.59
171 0.54
172 0.59
173 0.63
174 0.64
175 0.67
176 0.71
177 0.67
178 0.71
179 0.76
180 0.76
181 0.78
182 0.81
183 0.81
184 0.8
185 0.84
186 0.86
187 0.85
188 0.86
189 0.83
190 0.81
191 0.74
192 0.65
193 0.59
194 0.5
195 0.42
196 0.35
197 0.27
198 0.18
199 0.15
200 0.15
201 0.16
202 0.14
203 0.12
204 0.11
205 0.15
206 0.19
207 0.26
208 0.33
209 0.36
210 0.45
211 0.53
212 0.55
213 0.62
214 0.66
215 0.69
216 0.72
217 0.74
218 0.69
219 0.71