Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BBC1

Protein Details
Accession A0A2H3BBC1   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-44RNALPVKRSGRTRKMPRRQGLPIKYTHydrophilic
48-73AGRTFYKKEAARRKKRVARKLKDEAGBasic
NLS Segment(s)
PositionSequence
16-69PTARNALPVKRSGRTRKMPRRQGLPIKYTPNPAGRTFYKKEAARRKKRVARKLK
Subcellular Location(s) nucl 21, cyto_nucl 13.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVEHVERGATKKYRLPTARNALPVKRSGRTRKMPRRQGLPIKYTPNPAGRTFYKKEAARRKKRVARKLKDEAGDSEDKMEVDPAVKHDEGLSEPVLGPGTVKDAPDEPAPASSSAPTREDTLLSDSVNVGTVESPWIVRRSQAKILKEYFEHLGVLSPGFVTCSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.58
4 0.63
5 0.65
6 0.68
7 0.68
8 0.62
9 0.6
10 0.6
11 0.55
12 0.51
13 0.54
14 0.56
15 0.61
16 0.66
17 0.74
18 0.78
19 0.84
20 0.88
21 0.86
22 0.85
23 0.85
24 0.84
25 0.81
26 0.76
27 0.72
28 0.68
29 0.63
30 0.6
31 0.54
32 0.51
33 0.47
34 0.41
35 0.4
36 0.38
37 0.43
38 0.42
39 0.42
40 0.44
41 0.44
42 0.51
43 0.57
44 0.64
45 0.67
46 0.74
47 0.79
48 0.8
49 0.86
50 0.87
51 0.87
52 0.85
53 0.84
54 0.83
55 0.78
56 0.72
57 0.64
58 0.55
59 0.49
60 0.42
61 0.32
62 0.24
63 0.19
64 0.16
65 0.14
66 0.12
67 0.07
68 0.06
69 0.07
70 0.07
71 0.1
72 0.1
73 0.1
74 0.1
75 0.11
76 0.1
77 0.12
78 0.11
79 0.07
80 0.08
81 0.08
82 0.08
83 0.07
84 0.07
85 0.05
86 0.08
87 0.08
88 0.08
89 0.09
90 0.1
91 0.12
92 0.13
93 0.14
94 0.11
95 0.11
96 0.13
97 0.13
98 0.12
99 0.12
100 0.13
101 0.14
102 0.15
103 0.15
104 0.16
105 0.16
106 0.16
107 0.17
108 0.19
109 0.18
110 0.16
111 0.16
112 0.14
113 0.13
114 0.14
115 0.12
116 0.08
117 0.07
118 0.07
119 0.08
120 0.08
121 0.09
122 0.1
123 0.12
124 0.12
125 0.16
126 0.22
127 0.27
128 0.36
129 0.42
130 0.45
131 0.5
132 0.54
133 0.54
134 0.49
135 0.47
136 0.4
137 0.34
138 0.3
139 0.22
140 0.21
141 0.17
142 0.16
143 0.13
144 0.1
145 0.09
146 0.1