Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K1L0

Protein Details
Accession B6K1L0    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
17-42ALTKRQLPERPSRRKGRQAKRTIFVRHydrophilic
NLS Segment(s)
PositionSequence
16-37KALTKRQLPERPSRRKGRQAKR
68-86KRARKLAKKRLGTLGRAKA
Subcellular Location(s) mito 9.5mito_nucl 9.5, nucl 8.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MANQAPELIVGLNKGKALTKRQLPERPSRRKGRQAKRTIFVRSVVREVAGFAPYERRLMELIRNSQDKRARKLAKKRLGTLGRAKAKIEELSGVIQSSRLAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.2
4 0.26
5 0.32
6 0.38
7 0.45
8 0.53
9 0.61
10 0.62
11 0.68
12 0.72
13 0.75
14 0.76
15 0.79
16 0.78
17 0.81
18 0.86
19 0.86
20 0.86
21 0.86
22 0.84
23 0.82
24 0.78
25 0.72
26 0.63
27 0.57
28 0.51
29 0.42
30 0.37
31 0.3
32 0.24
33 0.2
34 0.19
35 0.15
36 0.11
37 0.09
38 0.07
39 0.1
40 0.1
41 0.11
42 0.1
43 0.1
44 0.1
45 0.12
46 0.17
47 0.18
48 0.23
49 0.27
50 0.31
51 0.31
52 0.37
53 0.43
54 0.43
55 0.44
56 0.5
57 0.55
58 0.6
59 0.7
60 0.74
61 0.77
62 0.78
63 0.76
64 0.76
65 0.72
66 0.69
67 0.68
68 0.67
69 0.65
70 0.6
71 0.56
72 0.49
73 0.47
74 0.43
75 0.35
76 0.27
77 0.2
78 0.21
79 0.21
80 0.19
81 0.15
82 0.14