Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3BIV5

Protein Details
Accession A0A2H3BIV5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
67-86DGPRRPEWKRGEKINRSPAKBasic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036279  5-3_exonuclease_C_sf  
IPR029060  PIN-like_dom_sf  
IPR006086  XPG-I_dom  
IPR006084  XPG/Rad2  
IPR006085  XPG_DNA_repair_N  
Gene Ontology GO:0004518  F:nuclease activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF00867  XPG_I  
PF00752  XPG_N  
CDD cd09870  PIN_YEN1  
Amino Acid Sequences MSLKSLTALALPMLSSPYRGLRLGIDVSLWLFHAGYSKGGENPELRLIFFRCCSLLKYPILPIFIFDGPRRPEWKRGEKINRSPAKLVTAVKAVVEAFGFEWRTAPGEAEAELAYLNEAGIIDAILTDDVDTFIFGAHTVIRNPSSTHPHDDKLKQHFHIYSEIQRSRADLILIALCSGGDYYAGLQGCGIKTALALVQCGFADSLYQAATSLPPASLPAFLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.16
5 0.18
6 0.19
7 0.19
8 0.18
9 0.22
10 0.22
11 0.2
12 0.17
13 0.14
14 0.14
15 0.13
16 0.12
17 0.09
18 0.07
19 0.07
20 0.1
21 0.1
22 0.11
23 0.13
24 0.14
25 0.16
26 0.17
27 0.19
28 0.17
29 0.19
30 0.24
31 0.22
32 0.21
33 0.22
34 0.23
35 0.23
36 0.23
37 0.21
38 0.17
39 0.18
40 0.2
41 0.22
42 0.26
43 0.25
44 0.26
45 0.29
46 0.3
47 0.31
48 0.27
49 0.24
50 0.22
51 0.21
52 0.22
53 0.18
54 0.22
55 0.23
56 0.27
57 0.31
58 0.3
59 0.37
60 0.44
61 0.54
62 0.54
63 0.61
64 0.68
65 0.73
66 0.79
67 0.81
68 0.78
69 0.7
70 0.66
71 0.57
72 0.49
73 0.43
74 0.35
75 0.27
76 0.22
77 0.19
78 0.17
79 0.16
80 0.13
81 0.09
82 0.08
83 0.06
84 0.05
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.09
91 0.08
92 0.08
93 0.07
94 0.07
95 0.07
96 0.08
97 0.07
98 0.06
99 0.06
100 0.05
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.02
107 0.02
108 0.02
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.06
126 0.06
127 0.08
128 0.09
129 0.1
130 0.12
131 0.15
132 0.22
133 0.24
134 0.3
135 0.32
136 0.34
137 0.4
138 0.44
139 0.47
140 0.48
141 0.51
142 0.46
143 0.48
144 0.46
145 0.41
146 0.42
147 0.38
148 0.37
149 0.4
150 0.4
151 0.38
152 0.36
153 0.35
154 0.32
155 0.29
156 0.23
157 0.14
158 0.14
159 0.14
160 0.14
161 0.12
162 0.1
163 0.08
164 0.08
165 0.07
166 0.05
167 0.03
168 0.04
169 0.04
170 0.08
171 0.08
172 0.08
173 0.09
174 0.11
175 0.11
176 0.12
177 0.12
178 0.08
179 0.08
180 0.09
181 0.11
182 0.09
183 0.1
184 0.09
185 0.11
186 0.11
187 0.12
188 0.11
189 0.08
190 0.09
191 0.08
192 0.09
193 0.07
194 0.08
195 0.07
196 0.08
197 0.08
198 0.09
199 0.1
200 0.09
201 0.09
202 0.11
203 0.12