Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3B3W1

Protein Details
Accession A0A2H3B3W1    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-83KDGKGRKDDKDGKKNDKDRKDDHKYYBasic
NLS Segment(s)
PositionSequence
61-73KGRKDDKDGKKND
Subcellular Location(s) nucl 17.5, mito_nucl 13.333, cyto_nucl 10.666, mito 7
Family & Domain DBs
Amino Acid Sequences MSCSQNARTFARRMTSATPARLKYSRDKSYDMFVCELFVEIIDIKTWEDDCDDDKDHKDGKGRKDDKDGKKNDKDRKDDHKYYDTSCWNAHYDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.42
4 0.45
5 0.47
6 0.44
7 0.48
8 0.47
9 0.47
10 0.48
11 0.52
12 0.53
13 0.5
14 0.52
15 0.48
16 0.53
17 0.53
18 0.45
19 0.37
20 0.29
21 0.26
22 0.21
23 0.2
24 0.12
25 0.08
26 0.06
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.05
35 0.05
36 0.06
37 0.08
38 0.1
39 0.12
40 0.13
41 0.15
42 0.17
43 0.19
44 0.2
45 0.26
46 0.29
47 0.34
48 0.44
49 0.47
50 0.48
51 0.57
52 0.65
53 0.68
54 0.72
55 0.73
56 0.72
57 0.78
58 0.84
59 0.83
60 0.82
61 0.8
62 0.78
63 0.8
64 0.8
65 0.78
66 0.76
67 0.74
68 0.68
69 0.65
70 0.65
71 0.6
72 0.53
73 0.48
74 0.44