Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3C7Q3

Protein Details
Accession A0A2H3C7Q3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
100-123TALSMERKCPHRRRVQLLRVRGDRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, extr 7, mito 5, E.R. 2, golg 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MHRVLRSTWERLSVAALVFMSGCVTTAVVMQMRSSYVLAFDILADHGQRNLFLQTIRTGPTKGLSVPFNKAYLRPGRSKTEFMIRVDGKPTRWYIHWMTTALSMERKCPHRRRVQLLRVRGDRGGFLRTLQIPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.19
3 0.17
4 0.12
5 0.11
6 0.1
7 0.08
8 0.06
9 0.06
10 0.05
11 0.05
12 0.05
13 0.06
14 0.07
15 0.08
16 0.09
17 0.08
18 0.09
19 0.09
20 0.1
21 0.1
22 0.08
23 0.07
24 0.07
25 0.07
26 0.07
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.07
36 0.08
37 0.08
38 0.08
39 0.08
40 0.09
41 0.1
42 0.11
43 0.13
44 0.13
45 0.13
46 0.12
47 0.13
48 0.13
49 0.12
50 0.13
51 0.14
52 0.15
53 0.17
54 0.18
55 0.18
56 0.18
57 0.18
58 0.2
59 0.24
60 0.26
61 0.28
62 0.31
63 0.36
64 0.39
65 0.41
66 0.38
67 0.41
68 0.41
69 0.37
70 0.41
71 0.35
72 0.33
73 0.35
74 0.35
75 0.28
76 0.27
77 0.28
78 0.23
79 0.23
80 0.27
81 0.26
82 0.31
83 0.32
84 0.3
85 0.28
86 0.28
87 0.29
88 0.25
89 0.26
90 0.19
91 0.21
92 0.27
93 0.33
94 0.4
95 0.48
96 0.56
97 0.62
98 0.71
99 0.77
100 0.82
101 0.85
102 0.84
103 0.85
104 0.85
105 0.79
106 0.73
107 0.65
108 0.55
109 0.49
110 0.42
111 0.36
112 0.27
113 0.23
114 0.26