Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K635

Protein Details
Accession B6K635    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
92-114YEKPTARRSRLRSERHRARFRAGBasic
NLS Segment(s)
PositionSequence
97-127ARRSRLRSERHRARFRAGIIRLVKMAKELRK
Subcellular Location(s) mito 18, nucl 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MISSLRKGTLHSWSGLIQPSISHFQKRFFANEPLQKVKEIALNAKRMQRMAPKYDLGATVSVRRSLSQTFSQLEALCARNNVRRQFYAQRFYEKPTARRSRLRSERHRARFRAGIIRLVKMAKELRKWGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.27
4 0.19
5 0.16
6 0.19
7 0.24
8 0.25
9 0.28
10 0.27
11 0.3
12 0.36
13 0.38
14 0.38
15 0.36
16 0.41
17 0.43
18 0.49
19 0.51
20 0.52
21 0.5
22 0.46
23 0.42
24 0.36
25 0.32
26 0.26
27 0.28
28 0.26
29 0.31
30 0.33
31 0.37
32 0.37
33 0.34
34 0.35
35 0.36
36 0.36
37 0.36
38 0.36
39 0.32
40 0.32
41 0.33
42 0.3
43 0.22
44 0.18
45 0.14
46 0.14
47 0.14
48 0.15
49 0.14
50 0.14
51 0.15
52 0.14
53 0.17
54 0.15
55 0.18
56 0.17
57 0.18
58 0.19
59 0.17
60 0.17
61 0.16
62 0.15
63 0.13
64 0.13
65 0.14
66 0.18
67 0.24
68 0.28
69 0.3
70 0.3
71 0.36
72 0.45
73 0.49
74 0.52
75 0.48
76 0.5
77 0.48
78 0.51
79 0.54
80 0.5
81 0.48
82 0.5
83 0.58
84 0.57
85 0.64
86 0.66
87 0.68
88 0.73
89 0.78
90 0.78
91 0.79
92 0.84
93 0.86
94 0.9
95 0.82
96 0.79
97 0.74
98 0.69
99 0.68
100 0.59
101 0.57
102 0.5
103 0.48
104 0.44
105 0.4
106 0.35
107 0.31
108 0.36
109 0.34
110 0.37