Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BZF4

Protein Details
Accession A0A2H3BZF4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-68LDVCTTYKNTRRTRKQCHDSGFSSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, mito 6, plas 6, E.R. 3, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSYVVLVTIPSFAAAFGYLILRGCRPGSGMATFPFLLIDYINIVLDVCTTYKNTRRTRKQCHDSGFSSSKGDTQIERK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.05
4 0.06
5 0.06
6 0.07
7 0.08
8 0.08
9 0.09
10 0.09
11 0.09
12 0.1
13 0.11
14 0.12
15 0.13
16 0.14
17 0.14
18 0.16
19 0.16
20 0.14
21 0.13
22 0.1
23 0.09
24 0.07
25 0.06
26 0.04
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.07
37 0.11
38 0.18
39 0.28
40 0.37
41 0.47
42 0.58
43 0.68
44 0.77
45 0.84
46 0.86
47 0.86
48 0.84
49 0.8
50 0.72
51 0.71
52 0.63
53 0.54
54 0.47
55 0.39
56 0.34
57 0.3
58 0.29