Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K1Y9

Protein Details
Accession B6K1Y9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-38TEKSSSKDQKESKKDDKKPEQVNVHydrophilic
NLS Segment(s)
PositionSequence
27-28KK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MEIDEIFASKKKTSTEKSSSKDQKESKKDDKKPEQVNVAKSQMKPKKMPKDDLFADPKGNTGRKRTEEGFLVYDEDELRIGKGGDTPLCPFDCDCCTYRLFISKAQASHRSSNSTRFLKKILAINFLVYTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.52
3 0.59
4 0.62
5 0.7
6 0.75
7 0.72
8 0.74
9 0.73
10 0.73
11 0.73
12 0.78
13 0.78
14 0.79
15 0.82
16 0.83
17 0.86
18 0.85
19 0.83
20 0.79
21 0.78
22 0.73
23 0.69
24 0.64
25 0.6
26 0.55
27 0.49
28 0.53
29 0.49
30 0.49
31 0.52
32 0.56
33 0.6
34 0.62
35 0.69
36 0.63
37 0.64
38 0.61
39 0.61
40 0.56
41 0.46
42 0.42
43 0.32
44 0.31
45 0.27
46 0.29
47 0.24
48 0.24
49 0.29
50 0.3
51 0.35
52 0.34
53 0.32
54 0.3
55 0.3
56 0.27
57 0.21
58 0.19
59 0.15
60 0.14
61 0.11
62 0.09
63 0.08
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.07
70 0.09
71 0.1
72 0.11
73 0.13
74 0.15
75 0.15
76 0.16
77 0.14
78 0.15
79 0.16
80 0.18
81 0.18
82 0.18
83 0.18
84 0.19
85 0.21
86 0.24
87 0.24
88 0.24
89 0.29
90 0.31
91 0.33
92 0.38
93 0.44
94 0.42
95 0.47
96 0.47
97 0.48
98 0.46
99 0.5
100 0.53
101 0.54
102 0.52
103 0.48
104 0.48
105 0.45
106 0.48
107 0.48
108 0.43
109 0.41
110 0.38
111 0.38