Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CD36

Protein Details
Accession A0A2H3CD36    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
209-239LEKRDGRPLKWLRDWRHRSRRSSESKAEPKABasic
NLS Segment(s)
PositionSequence
216-231PLKWLRDWRHRSRRSS
Subcellular Location(s) mito 11, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MDASRRAAEYTSLYDFVSPRLQEKNRPDFAHPPYVKVASFNRLMDLATTAEQLSSLVDLIPSWAKYHGRGMKTSTADVFVRRCDDFKCPQLALKVFGNFPLYQAKLTRPAAQQLLYTLHRTSAPLEDLLLTAAFFLIYQLGPLENDIVSLSILAAASVKADKHDLETALLTRIHKSLGIKEGSSGVRVEGTDLRAKWVMWHLREIDLGLEKRDGRPLKWLRDWRHRSRRSSESKAEPKAAVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.23
4 0.26
5 0.22
6 0.22
7 0.3
8 0.34
9 0.4
10 0.5
11 0.57
12 0.58
13 0.61
14 0.63
15 0.62
16 0.65
17 0.67
18 0.57
19 0.51
20 0.48
21 0.47
22 0.42
23 0.38
24 0.35
25 0.29
26 0.33
27 0.29
28 0.26
29 0.24
30 0.24
31 0.2
32 0.18
33 0.15
34 0.11
35 0.12
36 0.1
37 0.1
38 0.09
39 0.09
40 0.07
41 0.06
42 0.05
43 0.04
44 0.04
45 0.04
46 0.06
47 0.08
48 0.08
49 0.09
50 0.12
51 0.13
52 0.15
53 0.24
54 0.29
55 0.29
56 0.31
57 0.34
58 0.38
59 0.39
60 0.39
61 0.3
62 0.27
63 0.25
64 0.26
65 0.23
66 0.18
67 0.19
68 0.18
69 0.19
70 0.18
71 0.23
72 0.25
73 0.28
74 0.31
75 0.28
76 0.3
77 0.34
78 0.33
79 0.3
80 0.28
81 0.25
82 0.21
83 0.22
84 0.22
85 0.17
86 0.17
87 0.18
88 0.16
89 0.15
90 0.16
91 0.16
92 0.2
93 0.22
94 0.26
95 0.23
96 0.26
97 0.26
98 0.26
99 0.24
100 0.19
101 0.21
102 0.17
103 0.17
104 0.14
105 0.14
106 0.13
107 0.13
108 0.13
109 0.11
110 0.11
111 0.09
112 0.09
113 0.09
114 0.09
115 0.08
116 0.07
117 0.05
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.04
128 0.04
129 0.04
130 0.05
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.03
143 0.04
144 0.05
145 0.05
146 0.05
147 0.07
148 0.07
149 0.1
150 0.12
151 0.12
152 0.13
153 0.14
154 0.14
155 0.15
156 0.17
157 0.14
158 0.14
159 0.14
160 0.13
161 0.14
162 0.15
163 0.17
164 0.22
165 0.24
166 0.22
167 0.22
168 0.27
169 0.25
170 0.24
171 0.2
172 0.14
173 0.13
174 0.13
175 0.15
176 0.13
177 0.15
178 0.19
179 0.19
180 0.22
181 0.22
182 0.22
183 0.23
184 0.28
185 0.33
186 0.29
187 0.34
188 0.33
189 0.33
190 0.34
191 0.32
192 0.26
193 0.25
194 0.25
195 0.21
196 0.23
197 0.23
198 0.24
199 0.32
200 0.32
201 0.26
202 0.36
203 0.42
204 0.48
205 0.56
206 0.64
207 0.65
208 0.73
209 0.82
210 0.82
211 0.86
212 0.85
213 0.84
214 0.82
215 0.84
216 0.83
217 0.83
218 0.81
219 0.8
220 0.81
221 0.8
222 0.76