Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3C7U2

Protein Details
Accession A0A2H3C7U2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
39-60SFYDRWNKGKQWKDIRHKYVEAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 10, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008027  QCR9  
IPR036656  QCR9_sf  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF05365  UCR_UQCRX_QCR9  
Amino Acid Sequences MSFSTTLYNTFFKRNSVYVATIFAGAFGFGIGFDTALNSFYDRWNKGKQWKDIRHKYVEAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.28
4 0.28
5 0.23
6 0.25
7 0.22
8 0.19
9 0.18
10 0.14
11 0.1
12 0.08
13 0.07
14 0.04
15 0.04
16 0.02
17 0.04
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.05
24 0.05
25 0.06
26 0.06
27 0.1
28 0.17
29 0.19
30 0.23
31 0.29
32 0.35
33 0.44
34 0.52
35 0.58
36 0.63
37 0.71
38 0.78
39 0.82
40 0.84
41 0.82
42 0.76