Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CAA0

Protein Details
Accession A0A2H3CAA0    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-110GPGGRAERYKRRLENKQKIRERNFMLTQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFFQACSLRRIPHTLCQIRRYSEPAAAVKKPAQSAPKSSCPPDTVLTGLNYLKGQEPVLAKPDEEYPDWLWMLLEPRVIPDDGPGGRAERYKRRLENKQKIRERNFMLTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.59
4 0.61
5 0.58
6 0.58
7 0.54
8 0.46
9 0.41
10 0.4
11 0.38
12 0.39
13 0.36
14 0.36
15 0.34
16 0.35
17 0.32
18 0.32
19 0.32
20 0.29
21 0.36
22 0.39
23 0.44
24 0.44
25 0.44
26 0.43
27 0.39
28 0.39
29 0.33
30 0.28
31 0.21
32 0.19
33 0.18
34 0.17
35 0.15
36 0.13
37 0.11
38 0.11
39 0.1
40 0.09
41 0.09
42 0.1
43 0.11
44 0.11
45 0.15
46 0.14
47 0.13
48 0.14
49 0.16
50 0.15
51 0.15
52 0.17
53 0.15
54 0.17
55 0.17
56 0.16
57 0.13
58 0.12
59 0.14
60 0.11
61 0.11
62 0.09
63 0.1
64 0.12
65 0.12
66 0.11
67 0.09
68 0.14
69 0.13
70 0.14
71 0.14
72 0.14
73 0.15
74 0.2
75 0.25
76 0.3
77 0.36
78 0.44
79 0.52
80 0.6
81 0.7
82 0.77
83 0.82
84 0.83
85 0.88
86 0.89
87 0.9
88 0.89
89 0.87
90 0.82