Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0S0Y6

Protein Details
Accession T0S0Y6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-48CFPHHKRVPRHSHAKTKKKRLLGBasic
NLS Segment(s)
PositionSequence
31-46KRVPRHSHAKTKKKRL
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MRDYLIFVDIRQPNRPATVLLKRNVCFPHHKRVPRHSHAKTKKKRLLGAKEEEGDSCVYTNMFLCQGWQLQKTGLKLQKLSRTYEVQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.28
4 0.3
5 0.37
6 0.39
7 0.42
8 0.47
9 0.44
10 0.49
11 0.49
12 0.45
13 0.46
14 0.44
15 0.5
16 0.51
17 0.59
18 0.6
19 0.68
20 0.74
21 0.72
22 0.78
23 0.73
24 0.76
25 0.79
26 0.83
27 0.82
28 0.83
29 0.8
30 0.75
31 0.75
32 0.73
33 0.72
34 0.69
35 0.66
36 0.59
37 0.55
38 0.5
39 0.44
40 0.36
41 0.26
42 0.19
43 0.12
44 0.08
45 0.07
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.09
53 0.13
54 0.16
55 0.17
56 0.17
57 0.2
58 0.24
59 0.27
60 0.34
61 0.36
62 0.36
63 0.4
64 0.46
65 0.52
66 0.51
67 0.54
68 0.5