Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3BER0

Protein Details
Accession A0A2H3BER0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
57-91AEPKGGKPKGKQPKPPPKKTGGKQQTKGKGKAKATBasic
NLS Segment(s)
PositionSequence
29-91KGGKKNKDGKKISSTSKAARKPPKAIKGAEPKGGKPKGKQPKPPPKKTGGKQQTKGKGKAKAT
Subcellular Location(s) mito 12, cyto 8, nucl 5
Family & Domain DBs
Amino Acid Sequences MADATRPGPSIQSMVDRAVAARLKQLDTKGGKKNKDGKKISSTSKAARKPPKAIKGAEPKGGKPKGKQPKPPPKKTGGKQQTKGKGKAKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.19
4 0.18
5 0.21
6 0.21
7 0.16
8 0.19
9 0.2
10 0.2
11 0.23
12 0.23
13 0.26
14 0.29
15 0.36
16 0.41
17 0.46
18 0.47
19 0.52
20 0.61
21 0.62
22 0.67
23 0.64
24 0.61
25 0.62
26 0.64
27 0.61
28 0.59
29 0.54
30 0.5
31 0.53
32 0.53
33 0.53
34 0.56
35 0.56
36 0.58
37 0.62
38 0.64
39 0.61
40 0.58
41 0.58
42 0.6
43 0.6
44 0.59
45 0.52
46 0.46
47 0.51
48 0.55
49 0.5
50 0.43
51 0.5
52 0.54
53 0.61
54 0.69
55 0.7
56 0.76
57 0.83
58 0.89
59 0.86
60 0.85
61 0.87
62 0.83
63 0.84
64 0.83
65 0.83
66 0.81
67 0.84
68 0.85
69 0.84
70 0.86
71 0.82