Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K6Q6

Protein Details
Accession B6K6Q6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
26-55AKEFRFCRSKCHKNFKMKRNPRKVAWTKAYHydrophilic
167-189GKVPVLVSTKKRKNKNAASGSSAHydrophilic
NLS Segment(s)
PositionSequence
42-50MKRNPRKVA
Subcellular Location(s) mito 12, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0005840  C:ribosome  
GO:0001671  F:ATPase activator activity  
GO:0051117  F:ATPase binding  
GO:1902626  P:assembly of large subunit precursor of preribosome  
GO:0032781  P:positive regulation of ATP-dependent activity  
GO:0042273  P:ribosomal large subunit biogenesis  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIHTCYFCSGPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKMKRNPRKVAWTKAYRKAHGKEMVYDQSLAITAARRNVPVRYDRNLVATTLKAMKRVTEVHSKRERLFFKKRMAGKRDQEVREAQRLVQQNVPQFAEAVEEEEKMDEVPQILAEPEEMEQTTTAAPGKVPVLVSTKKRKNKNAASGSSAMDLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.24
4 0.22
5 0.21
6 0.21
7 0.21
8 0.18
9 0.21
10 0.19
11 0.2
12 0.21
13 0.24
14 0.3
15 0.29
16 0.33
17 0.4
18 0.4
19 0.49
20 0.56
21 0.63
22 0.66
23 0.75
24 0.77
25 0.79
26 0.89
27 0.89
28 0.9
29 0.91
30 0.91
31 0.91
32 0.9
33 0.84
34 0.85
35 0.82
36 0.8
37 0.79
38 0.78
39 0.75
40 0.78
41 0.79
42 0.74
43 0.74
44 0.67
45 0.66
46 0.62
47 0.56
48 0.49
49 0.49
50 0.47
51 0.4
52 0.36
53 0.27
54 0.21
55 0.19
56 0.16
57 0.1
58 0.08
59 0.07
60 0.11
61 0.12
62 0.13
63 0.14
64 0.16
65 0.18
66 0.24
67 0.28
68 0.28
69 0.31
70 0.3
71 0.32
72 0.31
73 0.28
74 0.22
75 0.17
76 0.15
77 0.18
78 0.17
79 0.16
80 0.16
81 0.16
82 0.17
83 0.2
84 0.21
85 0.27
86 0.28
87 0.35
88 0.42
89 0.44
90 0.43
91 0.49
92 0.5
93 0.47
94 0.54
95 0.52
96 0.53
97 0.57
98 0.62
99 0.64
100 0.65
101 0.66
102 0.62
103 0.65
104 0.66
105 0.6
106 0.56
107 0.54
108 0.52
109 0.49
110 0.44
111 0.35
112 0.33
113 0.36
114 0.35
115 0.33
116 0.32
117 0.29
118 0.31
119 0.32
120 0.26
121 0.21
122 0.19
123 0.17
124 0.13
125 0.13
126 0.11
127 0.1
128 0.1
129 0.1
130 0.1
131 0.08
132 0.09
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.07
140 0.06
141 0.07
142 0.06
143 0.08
144 0.08
145 0.08
146 0.08
147 0.09
148 0.09
149 0.09
150 0.09
151 0.08
152 0.08
153 0.09
154 0.1
155 0.11
156 0.11
157 0.13
158 0.18
159 0.24
160 0.32
161 0.41
162 0.5
163 0.57
164 0.66
165 0.73
166 0.78
167 0.83
168 0.86
169 0.85
170 0.81
171 0.79
172 0.73
173 0.65