Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JZJ5

Protein Details
Accession B6JZJ5    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
70-92RNITCSTRTRRKKIDFTKAKVPEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSSRSAKSQVDKGKAVAKKDPILDFDDDSEDVDFSDDGSENSYDDSDSSMDDEETGNENLQEDLAAIDPRNITCSTRTRRKKIDFTKAKVPEDELMDEDDEDDEDYIPPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.48
4 0.45
5 0.43
6 0.46
7 0.45
8 0.39
9 0.39
10 0.37
11 0.31
12 0.27
13 0.25
14 0.2
15 0.19
16 0.16
17 0.12
18 0.1
19 0.1
20 0.08
21 0.06
22 0.07
23 0.06
24 0.06
25 0.08
26 0.08
27 0.07
28 0.08
29 0.08
30 0.07
31 0.06
32 0.07
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.08
42 0.08
43 0.08
44 0.07
45 0.08
46 0.07
47 0.07
48 0.06
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.06
55 0.07
56 0.07
57 0.1
58 0.1
59 0.1
60 0.14
61 0.23
62 0.3
63 0.41
64 0.5
65 0.55
66 0.65
67 0.72
68 0.79
69 0.8
70 0.83
71 0.82
72 0.8
73 0.82
74 0.8
75 0.74
76 0.65
77 0.58
78 0.5
79 0.44
80 0.4
81 0.3
82 0.25
83 0.22
84 0.21
85 0.18
86 0.15
87 0.12
88 0.1
89 0.1
90 0.08