Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JWH3

Protein Details
Accession B6JWH3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-118LTPYEKSRKTLKQLKKERYFPLRKFHydrophilic
NLS Segment(s)
PositionSequence
83-117RQKKTRALRRALTPYEKSRKTLKQLKKERYFPLRK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003729  F:mRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MALKTFELRKQSAEQLAEQLTELRQELSSLRVQKIAGGSGSKLAKIKTARKDIARVLTVINENNRSAAREAYKNKKYIPLDLRQKKTRALRRALTPYEKSRKTLKQLKKERYFPLRKFALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.35
4 0.31
5 0.27
6 0.22
7 0.16
8 0.15
9 0.14
10 0.11
11 0.1
12 0.1
13 0.1
14 0.12
15 0.18
16 0.2
17 0.21
18 0.21
19 0.21
20 0.23
21 0.23
22 0.21
23 0.17
24 0.14
25 0.13
26 0.16
27 0.16
28 0.16
29 0.16
30 0.15
31 0.19
32 0.23
33 0.31
34 0.34
35 0.42
36 0.45
37 0.45
38 0.49
39 0.48
40 0.47
41 0.4
42 0.33
43 0.25
44 0.23
45 0.22
46 0.19
47 0.18
48 0.14
49 0.13
50 0.14
51 0.14
52 0.13
53 0.13
54 0.14
55 0.15
56 0.2
57 0.26
58 0.35
59 0.39
60 0.4
61 0.41
62 0.46
63 0.45
64 0.47
65 0.47
66 0.47
67 0.53
68 0.6
69 0.66
70 0.64
71 0.65
72 0.64
73 0.67
74 0.67
75 0.65
76 0.64
77 0.62
78 0.64
79 0.71
80 0.7
81 0.68
82 0.65
83 0.65
84 0.68
85 0.64
86 0.59
87 0.59
88 0.6
89 0.63
90 0.67
91 0.67
92 0.68
93 0.77
94 0.84
95 0.86
96 0.85
97 0.85
98 0.86
99 0.86
100 0.79
101 0.79
102 0.77