Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6JW77

Protein Details
Accession B6JW77   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
128-155GLSHSKSNSSRRRKPQVVKPRQRRNTLLHydrophilic
NLS Segment(s)
PositionSequence
137-149SRRRKPQVVKPRQ
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MGSNNPFKNEILRENSISSKKTVSLLDIDDEVAALGTRTFRSMSPGAPINNNTVLRRGNSARVRSSQENKPPVAKGNSISRSSSTASARFRHAEKQYLSDNKSGTSATGLSLQLPTKTPPSLPPRNAGLSHSKSNSSRRRKPQVVKPRQRRNTLLGIDKIDRLDVSGLYEGQASIHHDGPFDPCNPHRNKVSSRSPVAAFSAESLTGSLACVMPSSELPRISLDDGEPLGNELERTTTLADGINKTLSHTFSNPDGSITLAQLGAANEAASSRAKAVLPTVHVSPAEEDELVAGVETLGLGTTTRIEGTPASQAAIQRSLNQKGQGGMSPSSSLRRKRSIVAFFRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.49
4 0.46
5 0.41
6 0.36
7 0.33
8 0.34
9 0.32
10 0.27
11 0.27
12 0.27
13 0.26
14 0.24
15 0.23
16 0.19
17 0.17
18 0.14
19 0.1
20 0.07
21 0.05
22 0.05
23 0.07
24 0.07
25 0.09
26 0.1
27 0.1
28 0.17
29 0.19
30 0.19
31 0.23
32 0.28
33 0.29
34 0.32
35 0.34
36 0.32
37 0.37
38 0.38
39 0.34
40 0.33
41 0.33
42 0.3
43 0.34
44 0.32
45 0.35
46 0.4
47 0.45
48 0.45
49 0.48
50 0.53
51 0.55
52 0.59
53 0.58
54 0.61
55 0.61
56 0.59
57 0.58
58 0.54
59 0.53
60 0.5
61 0.44
62 0.39
63 0.42
64 0.45
65 0.43
66 0.42
67 0.37
68 0.35
69 0.34
70 0.35
71 0.29
72 0.29
73 0.31
74 0.33
75 0.35
76 0.35
77 0.36
78 0.39
79 0.39
80 0.41
81 0.38
82 0.4
83 0.44
84 0.48
85 0.48
86 0.44
87 0.4
88 0.33
89 0.33
90 0.28
91 0.21
92 0.15
93 0.12
94 0.1
95 0.13
96 0.12
97 0.11
98 0.13
99 0.14
100 0.13
101 0.14
102 0.15
103 0.14
104 0.15
105 0.15
106 0.21
107 0.29
108 0.37
109 0.38
110 0.4
111 0.41
112 0.44
113 0.44
114 0.39
115 0.39
116 0.35
117 0.37
118 0.34
119 0.34
120 0.34
121 0.43
122 0.5
123 0.51
124 0.56
125 0.62
126 0.7
127 0.76
128 0.81
129 0.82
130 0.84
131 0.85
132 0.86
133 0.87
134 0.88
135 0.87
136 0.85
137 0.78
138 0.72
139 0.69
140 0.62
141 0.57
142 0.48
143 0.43
144 0.38
145 0.35
146 0.3
147 0.21
148 0.17
149 0.12
150 0.1
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.06
158 0.06
159 0.06
160 0.07
161 0.08
162 0.11
163 0.11
164 0.11
165 0.11
166 0.14
167 0.15
168 0.15
169 0.15
170 0.14
171 0.23
172 0.26
173 0.29
174 0.3
175 0.34
176 0.37
177 0.43
178 0.51
179 0.49
180 0.48
181 0.48
182 0.44
183 0.4
184 0.37
185 0.29
186 0.2
187 0.14
188 0.13
189 0.09
190 0.09
191 0.08
192 0.06
193 0.06
194 0.06
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.06
202 0.09
203 0.11
204 0.11
205 0.12
206 0.13
207 0.15
208 0.15
209 0.15
210 0.12
211 0.12
212 0.12
213 0.11
214 0.1
215 0.09
216 0.08
217 0.08
218 0.07
219 0.06
220 0.06
221 0.06
222 0.07
223 0.07
224 0.07
225 0.08
226 0.1
227 0.12
228 0.12
229 0.13
230 0.14
231 0.14
232 0.15
233 0.17
234 0.17
235 0.17
236 0.17
237 0.18
238 0.19
239 0.23
240 0.21
241 0.2
242 0.18
243 0.17
244 0.16
245 0.14
246 0.13
247 0.08
248 0.08
249 0.09
250 0.09
251 0.08
252 0.07
253 0.07
254 0.06
255 0.06
256 0.07
257 0.07
258 0.07
259 0.07
260 0.1
261 0.1
262 0.11
263 0.14
264 0.16
265 0.19
266 0.21
267 0.21
268 0.21
269 0.21
270 0.21
271 0.2
272 0.19
273 0.17
274 0.14
275 0.13
276 0.11
277 0.11
278 0.1
279 0.08
280 0.06
281 0.04
282 0.04
283 0.04
284 0.03
285 0.03
286 0.03
287 0.03
288 0.04
289 0.05
290 0.06
291 0.07
292 0.07
293 0.08
294 0.09
295 0.11
296 0.16
297 0.15
298 0.16
299 0.17
300 0.19
301 0.22
302 0.27
303 0.25
304 0.26
305 0.33
306 0.37
307 0.4
308 0.41
309 0.39
310 0.36
311 0.38
312 0.36
313 0.34
314 0.29
315 0.27
316 0.27
317 0.26
318 0.32
319 0.37
320 0.41
321 0.44
322 0.5
323 0.52
324 0.58
325 0.66
326 0.68