Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K8G9

Protein Details
Accession B6K8G9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
150-179KVQHKRLYPDYKYQPQRNKKKYRNNITNEFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0009653  P:anatomical structure morphogenesis  
GO:0030154  P:cell differentiation  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MSCILSVKNMWALQNYSTKEALSSIENGSGSAYFVPSGYVPVLIPYSEANFQGLNIGLNFGIPVCEEISRCKVPRYIYKSMKEVKDAGTRKRTPRPANAFILYRRDKQAKILESLPGTSNAEVSRLVGAMWKNEKVEVKVQYFQKAELLKVQHKRLYPDYKYQPQRNKKKYRNNITNEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.31
4 0.3
5 0.29
6 0.26
7 0.25
8 0.22
9 0.17
10 0.17
11 0.14
12 0.16
13 0.16
14 0.16
15 0.16
16 0.14
17 0.12
18 0.1
19 0.09
20 0.06
21 0.06
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.07
28 0.08
29 0.09
30 0.08
31 0.09
32 0.08
33 0.1
34 0.11
35 0.11
36 0.11
37 0.1
38 0.1
39 0.11
40 0.1
41 0.09
42 0.07
43 0.08
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.05
51 0.05
52 0.06
53 0.07
54 0.1
55 0.16
56 0.19
57 0.2
58 0.21
59 0.24
60 0.27
61 0.35
62 0.4
63 0.44
64 0.48
65 0.51
66 0.55
67 0.58
68 0.55
69 0.48
70 0.42
71 0.36
72 0.37
73 0.37
74 0.37
75 0.4
76 0.43
77 0.46
78 0.53
79 0.57
80 0.54
81 0.6
82 0.62
83 0.59
84 0.59
85 0.56
86 0.51
87 0.44
88 0.48
89 0.41
90 0.35
91 0.34
92 0.33
93 0.31
94 0.34
95 0.39
96 0.34
97 0.34
98 0.33
99 0.32
100 0.29
101 0.3
102 0.24
103 0.19
104 0.17
105 0.14
106 0.14
107 0.11
108 0.12
109 0.1
110 0.1
111 0.09
112 0.07
113 0.07
114 0.09
115 0.1
116 0.14
117 0.17
118 0.18
119 0.18
120 0.21
121 0.24
122 0.24
123 0.29
124 0.3
125 0.31
126 0.36
127 0.38
128 0.42
129 0.4
130 0.38
131 0.37
132 0.33
133 0.3
134 0.3
135 0.33
136 0.34
137 0.41
138 0.47
139 0.46
140 0.47
141 0.52
142 0.56
143 0.6
144 0.57
145 0.6
146 0.63
147 0.69
148 0.76
149 0.79
150 0.81
151 0.82
152 0.88
153 0.89
154 0.9
155 0.91
156 0.92
157 0.93
158 0.94
159 0.94