Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3ALY8

Protein Details
Accession A0A2H3ALY8   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
20-45ESHHQSSNPPKRKKLRVSRNSCRFARHydrophilic
NLS Segment(s)
PositionSequence
31-32RK
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTFGRFSITFFNIRVIAKAESHHQSSNPPKRKKLRVSRNSCRFARLQVEEPLMCASLKHFRVAVYICCCRTETPAKYTARPSFIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.2
4 0.19
5 0.2
6 0.22
7 0.23
8 0.26
9 0.26
10 0.24
11 0.3
12 0.4
13 0.49
14 0.54
15 0.55
16 0.61
17 0.68
18 0.77
19 0.8
20 0.8
21 0.81
22 0.81
23 0.86
24 0.88
25 0.89
26 0.86
27 0.76
28 0.68
29 0.57
30 0.5
31 0.46
32 0.38
33 0.32
34 0.28
35 0.31
36 0.27
37 0.27
38 0.25
39 0.19
40 0.16
41 0.12
42 0.1
43 0.15
44 0.16
45 0.17
46 0.17
47 0.16
48 0.2
49 0.22
50 0.26
51 0.25
52 0.3
53 0.3
54 0.3
55 0.32
56 0.29
57 0.34
58 0.37
59 0.36
60 0.36
61 0.43
62 0.45
63 0.48
64 0.56
65 0.56