Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K6M8

Protein Details
Accession B6K6M8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-31GAKAARRREKLAKDKKPVKKSQLKANEAHydrophilic
NLS Segment(s)
PositionSequence
6-24KAARRREKLAKDKKPVKKS
Subcellular Location(s) nucl 14, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR039713  At2g23090-like  
IPR039438  At2g23090-like_Znf  
IPR007513  SERF-like_N  
IPR026939  ZNF706/At2g23090_sf  
Pfam View protein in Pfam  
PF04419  4F5  
PF12907  zf-met2  
Amino Acid Sequences MGNGAKAARRREKLAKDKKPVKKSQLKANEAAKTVICSICRTPFMRTIRRVALQGHAENKHDKTVEDCFPGWTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.79
4 0.86
5 0.88
6 0.89
7 0.87
8 0.86
9 0.85
10 0.8
11 0.8
12 0.8
13 0.74
14 0.71
15 0.68
16 0.62
17 0.53
18 0.48
19 0.38
20 0.29
21 0.26
22 0.21
23 0.15
24 0.13
25 0.13
26 0.14
27 0.17
28 0.18
29 0.19
30 0.25
31 0.32
32 0.37
33 0.39
34 0.42
35 0.43
36 0.44
37 0.43
38 0.37
39 0.37
40 0.34
41 0.35
42 0.37
43 0.34
44 0.35
45 0.38
46 0.38
47 0.36
48 0.32
49 0.28
50 0.26
51 0.3
52 0.32
53 0.32
54 0.31