Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K239

Protein Details
Accession B6K239    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-39LLEKPFRNPNYKAKPRRNRNLKQIVQNDPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0034080  P:CENP-A containing chromatin assembly  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MSTVESLDVSLLEKPFRNPNYKAKPRRNRNLKQIVQNDPAMSDPTQLTYVSIEAPPSFIPQKKFCDITGLLAPYTDPKTGLRYHNAEIYSILQELPPGVDQQYLKMRSSNIVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.26
3 0.31
4 0.37
5 0.39
6 0.49
7 0.58
8 0.67
9 0.75
10 0.77
11 0.82
12 0.86
13 0.92
14 0.92
15 0.9
16 0.9
17 0.9
18 0.86
19 0.85
20 0.81
21 0.77
22 0.7
23 0.63
24 0.52
25 0.41
26 0.35
27 0.28
28 0.21
29 0.15
30 0.11
31 0.11
32 0.12
33 0.11
34 0.1
35 0.09
36 0.09
37 0.08
38 0.08
39 0.07
40 0.06
41 0.07
42 0.07
43 0.09
44 0.11
45 0.12
46 0.16
47 0.2
48 0.25
49 0.27
50 0.28
51 0.26
52 0.29
53 0.27
54 0.27
55 0.26
56 0.22
57 0.19
58 0.18
59 0.18
60 0.15
61 0.16
62 0.13
63 0.11
64 0.11
65 0.14
66 0.19
67 0.23
68 0.26
69 0.29
70 0.3
71 0.34
72 0.34
73 0.3
74 0.27
75 0.26
76 0.21
77 0.17
78 0.16
79 0.11
80 0.1
81 0.1
82 0.1
83 0.09
84 0.08
85 0.09
86 0.13
87 0.13
88 0.18
89 0.27
90 0.28
91 0.29
92 0.3
93 0.31
94 0.3