Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3D2Z7

Protein Details
Accession A0A2H3D2Z7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
45-64NSSNKPKSLLRRRYRCPRFVHydrophilic
66-93LHFPEFWHRFRRKLRNRKKSCSIIQVLKHydrophilic
NLS Segment(s)
PositionSequence
76-84RRKLRNRKK
Subcellular Location(s) nucl 9.5, cyto_nucl 9.333, cyto 8, cyto_mito 7.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MTSHCQTCSFVTQHIYNLSVFVESCRNHFTDPRPVFNIPWSPSLNSSNKPKSLLRRRYRCPRFVVLHFPEFWHRFRRKLRNRKKSCSIIQVLKERP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.22
4 0.21
5 0.18
6 0.14
7 0.12
8 0.11
9 0.15
10 0.14
11 0.16
12 0.18
13 0.19
14 0.2
15 0.24
16 0.27
17 0.32
18 0.35
19 0.37
20 0.39
21 0.39
22 0.38
23 0.38
24 0.39
25 0.31
26 0.32
27 0.29
28 0.25
29 0.27
30 0.31
31 0.3
32 0.27
33 0.32
34 0.32
35 0.32
36 0.34
37 0.35
38 0.4
39 0.48
40 0.55
41 0.58
42 0.63
43 0.7
44 0.78
45 0.83
46 0.79
47 0.74
48 0.71
49 0.67
50 0.62
51 0.64
52 0.57
53 0.53
54 0.47
55 0.43
56 0.42
57 0.39
58 0.38
59 0.37
60 0.36
61 0.41
62 0.5
63 0.6
64 0.64
65 0.72
66 0.81
67 0.83
68 0.9
69 0.92
70 0.92
71 0.9
72 0.87
73 0.86
74 0.83
75 0.8
76 0.78