Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CY53

Protein Details
Accession A0A2H3CY53    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-38AGVPATPEPKPKRTRTRRTIKRTDAAKEHydrophilic
NLS Segment(s)
PositionSequence
19-32PKPKRTRTRRTIKR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009061  DNA-bd_dom_put_sf  
IPR037129  XPA_sf  
Gene Ontology GO:0005634  C:nucleus  
CDD cd21075  DBD_XPA-like  
Amino Acid Sequences MTAIPYAIPAAGVPATPEPKPKRTRTRRTIKRTDAAKEFRLKPADLDTLTPARQRDNPYGGKVTFYKIDEVVALAERLHEDPSSSQSPNRPPVTRKKKGGSTTKTDAMAHYSLQPVHMDGIKPREVKKNPHDESRSMYIYKVVDVEELAKEVHGPGYRLPKRPAKFFMMPDLDEDDLYPWYHKWY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.17
4 0.27
5 0.31
6 0.4
7 0.49
8 0.57
9 0.64
10 0.72
11 0.82
12 0.83
13 0.89
14 0.9
15 0.92
16 0.93
17 0.9
18 0.88
19 0.83
20 0.8
21 0.78
22 0.73
23 0.69
24 0.67
25 0.61
26 0.58
27 0.56
28 0.49
29 0.41
30 0.4
31 0.38
32 0.3
33 0.29
34 0.26
35 0.26
36 0.27
37 0.28
38 0.23
39 0.21
40 0.26
41 0.29
42 0.32
43 0.35
44 0.38
45 0.39
46 0.43
47 0.4
48 0.37
49 0.33
50 0.29
51 0.25
52 0.23
53 0.21
54 0.16
55 0.16
56 0.13
57 0.13
58 0.11
59 0.08
60 0.08
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.12
70 0.15
71 0.15
72 0.16
73 0.19
74 0.24
75 0.31
76 0.34
77 0.32
78 0.33
79 0.43
80 0.52
81 0.56
82 0.57
83 0.55
84 0.59
85 0.64
86 0.7
87 0.64
88 0.61
89 0.58
90 0.55
91 0.52
92 0.45
93 0.37
94 0.31
95 0.26
96 0.19
97 0.16
98 0.14
99 0.12
100 0.13
101 0.13
102 0.09
103 0.1
104 0.11
105 0.1
106 0.11
107 0.16
108 0.2
109 0.22
110 0.25
111 0.33
112 0.36
113 0.44
114 0.51
115 0.57
116 0.56
117 0.64
118 0.64
119 0.57
120 0.59
121 0.56
122 0.5
123 0.4
124 0.36
125 0.3
126 0.27
127 0.25
128 0.2
129 0.14
130 0.11
131 0.11
132 0.13
133 0.1
134 0.1
135 0.1
136 0.08
137 0.08
138 0.08
139 0.12
140 0.12
141 0.13
142 0.16
143 0.27
144 0.34
145 0.4
146 0.46
147 0.51
148 0.54
149 0.6
150 0.62
151 0.59
152 0.6
153 0.57
154 0.6
155 0.56
156 0.52
157 0.47
158 0.45
159 0.38
160 0.31
161 0.28
162 0.2
163 0.16
164 0.17
165 0.15