Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JZK2

Protein Details
Accession B6JZK2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
168-187GDRYQGGKKKDKKEKGESSTBasic
NLS Segment(s)
PositionSequence
175-181KKKDKKE
Subcellular Location(s) cyto_nucl 11.333, cyto 11, nucl 10.5, cyto_mito 7.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0106335  F:tRNA (carboxymethyluridine(34)-5-O)-methyltransferase activity  
GO:0000049  F:tRNA binding  
GO:0030488  P:tRNA methylation  
GO:0002098  P:tRNA wobble uridine modification  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MAALSEEAYEEEHVHRVYDQIANHFSATRYKPWPVVDRYLSSLSPGSVGVDVGCGNGKYLGLNSNAYLIGNDRCSNLVRIASNRGPALVADGLAAPHPTGRFDFAISIAVIHHFSTPERRREGIAEVLRVLRPQGTALFFVWALEQQNSRRGWKEGDSQDVYVPWVLGDRYQGGKKKDKKEKGESSTGSPAASSVATEAADASELVSAASSKPEPVVYQRYYHLFKKGELEECIQSVGGTVMKAAMTGITGGRLLNGSATSNARPLHGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.17
5 0.2
6 0.21
7 0.22
8 0.25
9 0.26
10 0.26
11 0.26
12 0.24
13 0.28
14 0.3
15 0.31
16 0.33
17 0.34
18 0.38
19 0.43
20 0.5
21 0.48
22 0.53
23 0.51
24 0.49
25 0.51
26 0.49
27 0.43
28 0.37
29 0.32
30 0.24
31 0.2
32 0.17
33 0.13
34 0.1
35 0.1
36 0.08
37 0.07
38 0.07
39 0.07
40 0.08
41 0.07
42 0.07
43 0.08
44 0.08
45 0.07
46 0.08
47 0.11
48 0.12
49 0.13
50 0.12
51 0.14
52 0.14
53 0.13
54 0.12
55 0.11
56 0.11
57 0.13
58 0.14
59 0.13
60 0.14
61 0.16
62 0.17
63 0.17
64 0.18
65 0.17
66 0.19
67 0.25
68 0.26
69 0.27
70 0.25
71 0.24
72 0.21
73 0.18
74 0.19
75 0.12
76 0.1
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.05
83 0.06
84 0.06
85 0.07
86 0.07
87 0.1
88 0.1
89 0.1
90 0.11
91 0.1
92 0.12
93 0.1
94 0.1
95 0.07
96 0.08
97 0.08
98 0.07
99 0.07
100 0.06
101 0.07
102 0.17
103 0.22
104 0.27
105 0.29
106 0.3
107 0.3
108 0.32
109 0.34
110 0.32
111 0.29
112 0.24
113 0.22
114 0.23
115 0.22
116 0.2
117 0.17
118 0.1
119 0.08
120 0.07
121 0.08
122 0.08
123 0.09
124 0.1
125 0.1
126 0.09
127 0.09
128 0.09
129 0.08
130 0.08
131 0.08
132 0.1
133 0.1
134 0.16
135 0.18
136 0.19
137 0.21
138 0.21
139 0.22
140 0.23
141 0.31
142 0.28
143 0.33
144 0.33
145 0.32
146 0.31
147 0.29
148 0.26
149 0.17
150 0.14
151 0.07
152 0.07
153 0.06
154 0.06
155 0.07
156 0.08
157 0.11
158 0.16
159 0.21
160 0.25
161 0.35
162 0.43
163 0.52
164 0.61
165 0.67
166 0.71
167 0.77
168 0.82
169 0.79
170 0.79
171 0.71
172 0.66
173 0.62
174 0.53
175 0.43
176 0.32
177 0.26
178 0.18
179 0.16
180 0.11
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.05
187 0.06
188 0.05
189 0.05
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.07
197 0.07
198 0.07
199 0.08
200 0.09
201 0.11
202 0.16
203 0.24
204 0.24
205 0.27
206 0.3
207 0.35
208 0.39
209 0.41
210 0.43
211 0.37
212 0.37
213 0.42
214 0.43
215 0.42
216 0.41
217 0.42
218 0.36
219 0.34
220 0.33
221 0.25
222 0.2
223 0.15
224 0.13
225 0.1
226 0.08
227 0.07
228 0.07
229 0.07
230 0.07
231 0.07
232 0.06
233 0.05
234 0.06
235 0.07
236 0.07
237 0.07
238 0.07
239 0.08
240 0.08
241 0.08
242 0.09
243 0.09
244 0.1
245 0.13
246 0.16
247 0.17
248 0.21
249 0.22