Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JYN8

Protein Details
Accession B6JYN8    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
89-116TEIWKQPPSVHRRARKQSIRMENLRRKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSFHSKISAQSLRLMRSLRNLRLGICVQARLFSRAAPLFRPPSSTVAGTIMKGLSIHKNEPDPVAKEDNEYPDWLWTLLDETKPVLEPTEIWKQPPSVHRRARKQSIRMENLRRKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.38
4 0.45
5 0.41
6 0.44
7 0.42
8 0.39
9 0.43
10 0.43
11 0.38
12 0.31
13 0.3
14 0.22
15 0.25
16 0.26
17 0.23
18 0.22
19 0.18
20 0.21
21 0.21
22 0.22
23 0.2
24 0.24
25 0.25
26 0.25
27 0.29
28 0.26
29 0.26
30 0.27
31 0.26
32 0.21
33 0.2
34 0.21
35 0.17
36 0.15
37 0.12
38 0.1
39 0.09
40 0.1
41 0.11
42 0.12
43 0.13
44 0.14
45 0.16
46 0.16
47 0.18
48 0.2
49 0.18
50 0.19
51 0.21
52 0.2
53 0.21
54 0.22
55 0.24
56 0.22
57 0.2
58 0.17
59 0.15
60 0.15
61 0.13
62 0.11
63 0.07
64 0.09
65 0.1
66 0.1
67 0.1
68 0.1
69 0.11
70 0.12
71 0.12
72 0.1
73 0.09
74 0.09
75 0.14
76 0.24
77 0.24
78 0.25
79 0.27
80 0.27
81 0.33
82 0.41
83 0.43
84 0.44
85 0.53
86 0.61
87 0.69
88 0.78
89 0.83
90 0.84
91 0.84
92 0.84
93 0.86
94 0.85
95 0.85
96 0.85