Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6JUS1

Protein Details
Accession B6JUS1   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-71LLLNKKHTSRREKIRKHQERRQQRRMYKVQRFEEBasic
NLS Segment(s)
PositionSequence
43-61KHTSRREKIRKHQERRQQR
Subcellular Location(s) nucl 17, mito 4, plas 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MSLVTICPLSETFIRLTMQMHPELDTQDQTAVRGLLYLLLNKKHTSRREKIRKHQERRQQRRMYKVQRFEEFLHLRFPLSQHPYGRHSSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.19
5 0.22
6 0.22
7 0.21
8 0.2
9 0.2
10 0.22
11 0.22
12 0.18
13 0.15
14 0.15
15 0.15
16 0.14
17 0.13
18 0.11
19 0.09
20 0.09
21 0.08
22 0.08
23 0.08
24 0.11
25 0.12
26 0.14
27 0.16
28 0.17
29 0.2
30 0.24
31 0.31
32 0.37
33 0.43
34 0.52
35 0.61
36 0.7
37 0.77
38 0.81
39 0.85
40 0.86
41 0.87
42 0.86
43 0.87
44 0.88
45 0.88
46 0.87
47 0.82
48 0.83
49 0.85
50 0.85
51 0.83
52 0.82
53 0.79
54 0.73
55 0.72
56 0.64
57 0.64
58 0.57
59 0.49
60 0.43
61 0.36
62 0.33
63 0.3
64 0.28
65 0.27
66 0.3
67 0.34
68 0.35
69 0.4
70 0.43