Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3E0L6

Protein Details
Accession A0A2H3E0L6   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-110GPGGRAERYKRRLENKQKIRERNFMLTQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFFQTCSLRRIPHTLCQIRRYSEPAAAVKKPAQSAPKSSCTADTVLTGLNYLKGQEPVLAKPDEEYPDWLWTLLEPRVIPDDGPGGRAERYKRRLENKQKIRERNFMLTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.62
4 0.63
5 0.59
6 0.58
7 0.54
8 0.46
9 0.41
10 0.4
11 0.38
12 0.39
13 0.36
14 0.36
15 0.34
16 0.35
17 0.32
18 0.32
19 0.32
20 0.29
21 0.36
22 0.38
23 0.41
24 0.4
25 0.39
26 0.37
27 0.32
28 0.31
29 0.24
30 0.19
31 0.13
32 0.11
33 0.11
34 0.09
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.1
43 0.11
44 0.11
45 0.15
46 0.14
47 0.13
48 0.14
49 0.16
50 0.15
51 0.15
52 0.17
53 0.15
54 0.17
55 0.17
56 0.16
57 0.14
58 0.12
59 0.14
60 0.12
61 0.12
62 0.1
63 0.12
64 0.15
65 0.15
66 0.15
67 0.12
68 0.17
69 0.15
70 0.16
71 0.16
72 0.14
73 0.15
74 0.2
75 0.25
76 0.3
77 0.36
78 0.44
79 0.52
80 0.6
81 0.7
82 0.77
83 0.82
84 0.83
85 0.88
86 0.89
87 0.9
88 0.89
89 0.87
90 0.82