Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3E4P2

Protein Details
Accession A0A2H3E4P2    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
187-215EAMERKRLSEPPKKSKKRKNVSPPNEAPAHydrophilic
NLS Segment(s)
PositionSequence
190-218ERKRLSEPPKKSKKRKNVSPPNEAPASKK
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006735  Rtf2  
IPR027799  Rtf2_RING-finger  
Gene Ontology GO:0005634  C:nucleus  
GO:1902979  P:mitotic DNA replication termination  
Pfam View protein in Pfam  
PF04641  Rtf2  
CDD cd16653  RING-like_Rtf2  
Amino Acid Sequences MGNDGGSIPDRRDLVRNKPKAEQADKANQTRAKWFFCALSKRILQEPIVACALGKLYNKDSILEYLLDKSAYGDGEDICGHIRSLKDVKTLSLTPNPTPPSPDATTNHAQFICPITLKEMNGLLPFVYIANCGCVFSQAGLKNVSTTPKEEDGEQLDVCPQCAKKFSRTSDIIPLNPQPEEEERMREAMERKRLSEPPKKSKKRKNVSPPNEAPASKKAPGMNPGIAAASRAVVSSLAMEEAKRKANMSEAVKSLYSEGKPKRKETFTTMGTFTRYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.57
4 0.58
5 0.63
6 0.68
7 0.7
8 0.69
9 0.65
10 0.63
11 0.65
12 0.68
13 0.66
14 0.67
15 0.61
16 0.57
17 0.58
18 0.56
19 0.49
20 0.44
21 0.41
22 0.38
23 0.42
24 0.48
25 0.41
26 0.43
27 0.41
28 0.42
29 0.44
30 0.42
31 0.35
32 0.35
33 0.35
34 0.31
35 0.29
36 0.25
37 0.21
38 0.19
39 0.19
40 0.15
41 0.15
42 0.15
43 0.17
44 0.22
45 0.22
46 0.23
47 0.24
48 0.21
49 0.21
50 0.19
51 0.18
52 0.15
53 0.15
54 0.14
55 0.12
56 0.11
57 0.11
58 0.1
59 0.09
60 0.08
61 0.08
62 0.09
63 0.09
64 0.09
65 0.08
66 0.09
67 0.08
68 0.1
69 0.1
70 0.13
71 0.17
72 0.18
73 0.22
74 0.22
75 0.23
76 0.25
77 0.27
78 0.26
79 0.28
80 0.29
81 0.26
82 0.31
83 0.33
84 0.29
85 0.31
86 0.28
87 0.28
88 0.27
89 0.31
90 0.27
91 0.3
92 0.35
93 0.33
94 0.34
95 0.28
96 0.26
97 0.22
98 0.22
99 0.17
100 0.13
101 0.12
102 0.13
103 0.15
104 0.15
105 0.15
106 0.13
107 0.13
108 0.13
109 0.13
110 0.09
111 0.07
112 0.07
113 0.06
114 0.05
115 0.04
116 0.04
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.07
124 0.12
125 0.11
126 0.13
127 0.14
128 0.14
129 0.14
130 0.15
131 0.17
132 0.13
133 0.14
134 0.15
135 0.17
136 0.18
137 0.17
138 0.18
139 0.18
140 0.2
141 0.18
142 0.15
143 0.15
144 0.14
145 0.14
146 0.14
147 0.12
148 0.11
149 0.17
150 0.19
151 0.23
152 0.31
153 0.34
154 0.39
155 0.42
156 0.44
157 0.47
158 0.48
159 0.42
160 0.37
161 0.36
162 0.3
163 0.27
164 0.25
165 0.18
166 0.17
167 0.21
168 0.19
169 0.2
170 0.19
171 0.2
172 0.2
173 0.21
174 0.24
175 0.27
176 0.35
177 0.33
178 0.35
179 0.4
180 0.46
181 0.51
182 0.55
183 0.58
184 0.59
185 0.69
186 0.77
187 0.82
188 0.87
189 0.89
190 0.91
191 0.92
192 0.92
193 0.92
194 0.9
195 0.9
196 0.84
197 0.79
198 0.73
199 0.63
200 0.55
201 0.51
202 0.48
203 0.39
204 0.38
205 0.35
206 0.34
207 0.38
208 0.39
209 0.34
210 0.29
211 0.28
212 0.26
213 0.22
214 0.19
215 0.14
216 0.1
217 0.08
218 0.07
219 0.07
220 0.06
221 0.06
222 0.06
223 0.07
224 0.07
225 0.08
226 0.08
227 0.11
228 0.15
229 0.2
230 0.2
231 0.21
232 0.2
233 0.26
234 0.33
235 0.35
236 0.38
237 0.35
238 0.37
239 0.36
240 0.36
241 0.32
242 0.3
243 0.27
244 0.3
245 0.37
246 0.44
247 0.5
248 0.56
249 0.63
250 0.64
251 0.67
252 0.67
253 0.67
254 0.62
255 0.61
256 0.58
257 0.52