Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3DJR5

Protein Details
Accession A0A2H3DJR5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
15-34VRVSRWRLRRHESRIVRCKEBasic
NLS Segment(s)
Subcellular Location(s) cysk 9, mito 8, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTHDIHESLTALIAVRVSRWRLRRHESRIVRCKEISRRMLPITVQRNQGHCRLPMVVRLHTIKTQVTVIDQNIPNDGRISGTRSCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.12
4 0.16
5 0.22
6 0.28
7 0.36
8 0.43
9 0.52
10 0.6
11 0.64
12 0.71
13 0.74
14 0.78
15 0.8
16 0.77
17 0.73
18 0.65
19 0.63
20 0.61
21 0.6
22 0.56
23 0.49
24 0.48
25 0.45
26 0.45
27 0.39
28 0.38
29 0.35
30 0.33
31 0.36
32 0.34
33 0.37
34 0.38
35 0.41
36 0.36
37 0.31
38 0.29
39 0.25
40 0.24
41 0.26
42 0.28
43 0.24
44 0.25
45 0.27
46 0.28
47 0.27
48 0.28
49 0.22
50 0.2
51 0.2
52 0.17
53 0.17
54 0.18
55 0.18
56 0.24
57 0.25
58 0.24
59 0.27
60 0.27
61 0.25
62 0.23
63 0.22
64 0.16
65 0.16
66 0.2