Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DI13

Protein Details
Accession A0A2H3DI13    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
190-213NTARVYNWDVKRRRERREKEALEGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016655  PFD3  
IPR009053  Prefoldin  
IPR004127  Prefoldin_subunit_alpha  
Gene Ontology GO:0016272  C:prefoldin complex  
GO:0006457  P:protein folding  
Pfam View protein in Pfam  
PF02996  Prefoldin  
Amino Acid Sequences MASGKLQAVVSEERNPRGIPKAPFIADVEEYVGGSDGDIESPLKAFQDAMAKYRYMDDNLAQRRKGLEEKIPDYKKTLDMVEYLQERREGKSKASEGDDLADDLDDEVDNSSSKPIRTTFELNETLYAEAELEETDTVYLWLGANVMLSYKIPEAIALLKSKLEAAETSLENTIEDLEFIREQLTIMEVNTARVYNWDVKRRRERREKEALEGSSTTIQGDSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.34
4 0.36
5 0.4
6 0.35
7 0.38
8 0.42
9 0.41
10 0.42
11 0.41
12 0.38
13 0.32
14 0.28
15 0.23
16 0.17
17 0.16
18 0.14
19 0.12
20 0.08
21 0.07
22 0.07
23 0.05
24 0.05
25 0.06
26 0.06
27 0.06
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.16
35 0.17
36 0.19
37 0.21
38 0.21
39 0.21
40 0.24
41 0.24
42 0.18
43 0.19
44 0.19
45 0.27
46 0.35
47 0.4
48 0.36
49 0.36
50 0.35
51 0.37
52 0.38
53 0.33
54 0.31
55 0.34
56 0.39
57 0.47
58 0.49
59 0.46
60 0.44
61 0.42
62 0.38
63 0.32
64 0.28
65 0.19
66 0.18
67 0.18
68 0.2
69 0.2
70 0.18
71 0.17
72 0.19
73 0.19
74 0.2
75 0.25
76 0.22
77 0.21
78 0.28
79 0.28
80 0.28
81 0.3
82 0.29
83 0.23
84 0.23
85 0.21
86 0.14
87 0.12
88 0.09
89 0.07
90 0.05
91 0.05
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.04
98 0.06
99 0.07
100 0.07
101 0.09
102 0.1
103 0.12
104 0.15
105 0.19
106 0.19
107 0.24
108 0.26
109 0.24
110 0.24
111 0.22
112 0.19
113 0.15
114 0.14
115 0.08
116 0.06
117 0.06
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.09
143 0.12
144 0.12
145 0.12
146 0.12
147 0.12
148 0.13
149 0.11
150 0.1
151 0.08
152 0.09
153 0.13
154 0.13
155 0.15
156 0.15
157 0.15
158 0.14
159 0.14
160 0.12
161 0.08
162 0.08
163 0.07
164 0.09
165 0.09
166 0.09
167 0.09
168 0.08
169 0.08
170 0.08
171 0.09
172 0.07
173 0.07
174 0.12
175 0.12
176 0.14
177 0.15
178 0.15
179 0.13
180 0.14
181 0.18
182 0.22
183 0.3
184 0.38
185 0.43
186 0.53
187 0.64
188 0.72
189 0.78
190 0.81
191 0.82
192 0.82
193 0.87
194 0.82
195 0.79
196 0.79
197 0.7
198 0.63
199 0.55
200 0.48
201 0.4
202 0.35
203 0.27