Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3E5N1

Protein Details
Accession A0A2H3E5N1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
118-138YENPNAKRAKKGKPNTIQAASHydrophilic
NLS Segment(s)
PositionSequence
125-128RAKK
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR032053  MRP-S34  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF16053  MRP-S34  
Amino Acid Sequences MLWTLARHDLASIIKRSIPASKAPPSLSKNPGNLYEVLSRTPLGGVGRHVYQTRWTAKKIPDCYWKVTRTQFKCEGKHGKAWGLLFWKGKQVSEQPERIRGSLKYSWNEGRSEGVWDYENPNAKRAKKGKPNTIQAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.28
4 0.3
5 0.27
6 0.28
7 0.32
8 0.37
9 0.4
10 0.41
11 0.47
12 0.47
13 0.53
14 0.53
15 0.52
16 0.49
17 0.48
18 0.48
19 0.43
20 0.38
21 0.34
22 0.32
23 0.28
24 0.25
25 0.22
26 0.2
27 0.17
28 0.16
29 0.14
30 0.1
31 0.1
32 0.11
33 0.12
34 0.13
35 0.14
36 0.15
37 0.14
38 0.17
39 0.22
40 0.27
41 0.28
42 0.29
43 0.33
44 0.38
45 0.46
46 0.47
47 0.47
48 0.49
49 0.49
50 0.53
51 0.53
52 0.49
53 0.46
54 0.48
55 0.51
56 0.45
57 0.49
58 0.52
59 0.52
60 0.53
61 0.56
62 0.58
63 0.51
64 0.53
65 0.48
66 0.41
67 0.38
68 0.36
69 0.3
70 0.25
71 0.26
72 0.23
73 0.22
74 0.25
75 0.23
76 0.23
77 0.23
78 0.25
79 0.3
80 0.34
81 0.41
82 0.37
83 0.44
84 0.45
85 0.43
86 0.41
87 0.34
88 0.34
89 0.34
90 0.38
91 0.33
92 0.37
93 0.42
94 0.41
95 0.42
96 0.36
97 0.33
98 0.27
99 0.28
100 0.23
101 0.19
102 0.18
103 0.19
104 0.2
105 0.22
106 0.3
107 0.27
108 0.32
109 0.37
110 0.38
111 0.47
112 0.52
113 0.58
114 0.6
115 0.69
116 0.75
117 0.78
118 0.85