FuNGI

B6K8B9

Protein Details

Accession

B6K8B9

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
47-78	GVYYVHTQKQKSKKSKKYRKIPSDEKLKKMPQ	Hydrophilic
118-147	AAEAAASLKKKKNKKKKSKKKVDDEKIALT	Hydrophilic

NLS Segment(s)

Position	Sequence
56-74	QKSKKSKKYRKIPSDEKLK
125-138	LKKKKNKKKKSKKK

Subcellular Location(s)

cyto 11.5, cyto_nucl 11, nucl 7.5, mito 4, pero 1, E.R. 1, cysk 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR011990 TPR-like_helical_dom_sf IPR013105 TPR_2 IPR019734 TPR_repeat
Gene Ontology	GO:0016020 C:membrane GO:0005739 C:mitochondrion GO:0030943 F:mitochondrion targeting sequence binding GO:0030150 P:protein import into mitochondrial matrix GO:0045039 P:protein insertion into mitochondrial inner membrane
Pfam	View protein in Pfam PF13432 TPR_16 PF07719 TPR_2 PF13174 TPR_6 PF13181 TPR_8
PROSITE	View protein in PROSITE PS50005 TPR

Amino Acid Sequences

MPEPAIVSVSVPAENHGLWSSFTSFVERHKKLVYTTGILAVCAGVGGVYYVHTQKQKSKKSKKYRKIPSDEKLKKMPQSEENVDTAEKQTSSVTETKQEPVSQSEAVDAKTDLAAAGAAEAAASLKKKKNKKKKSKKKVDDEKIALTAQKLKEMSQEEREKLATELKTEGNLAYGRKDYVKAIELYTQAIIYNRDPIYFSNRAACFAAIGDYNKVVSDTSEALSMNPTYVKALNRRAAAYEQLDRLDEALMDCTVSCIFDGFTNEALTASVERLLKKVAERKAEALMKTRERKLPSATFIRTYLDSFRAQPALEYENGNEGDAALAASIEALEQGKFAESQELVNKACATGCSSDKLSARAYNLVGTYKFVSGDSKESIADFEKAIELDPTFIQPYVRLGAAYLDENERDKMWKTFEKAESVSTTDPDLYYHRAQVHFISGDFAKAIKDYRKSNELDDTFIYGYIQLAVAQYKSNEVEEAVKTFEMCKERFPDSGEVYNYYGEILLDQQKFDEALDHFDRAIELGKKKSAQNVMNAMPLINKALTVFQAKRDVDQAEKLCQQALDADPECDIAVASMAQFLLQQGKPVEALKYFEKSADLARTESEMVNAFSYSEATRTQIALTDRYPELVGRLNPVV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.16
3	0.15
4	0.14
5	0.14
6	0.17
7	0.18
8	0.18
9	0.19
10	0.21
11	0.2
12	0.29
13	0.39
14	0.37
15	0.39
16	0.41
17	0.43
18	0.41
19	0.49
20	0.45
21	0.38
22	0.38
23	0.41
24	0.36
25	0.33
26	0.31
27	0.23
28	0.17
29	0.12
30	0.1
31	0.03
32	0.03
33	0.03
34	0.03
35	0.05
36	0.07
37	0.09
38	0.14
39	0.19
40	0.23
41	0.32
42	0.42
43	0.52
44	0.61
45	0.7
46	0.77
47	0.84
48	0.92
49	0.94
50	0.94
51	0.95
52	0.95
53	0.94
54	0.93
55	0.91
56	0.91
57	0.89
58	0.85
59	0.83
60	0.78
61	0.74
62	0.7
63	0.67
64	0.63
65	0.64
66	0.63
67	0.57
68	0.52
69	0.48
70	0.42
71	0.37
72	0.31
73	0.25
74	0.19
75	0.16
76	0.15
77	0.14
78	0.18
79	0.21
80	0.21
81	0.24
82	0.27
83	0.3
84	0.33
85	0.34
86	0.31
87	0.3
88	0.32
89	0.27
90	0.25
91	0.25
92	0.23
93	0.22
94	0.21
95	0.17
96	0.14
97	0.13
98	0.13
99	0.09
100	0.07
101	0.07
102	0.05
103	0.05
104	0.04
105	0.03
106	0.03
107	0.03
108	0.04
109	0.05
110	0.07
111	0.13
112	0.19
113	0.27
114	0.38
115	0.49
116	0.6
117	0.7
118	0.8
119	0.86
120	0.92
121	0.95
122	0.97
123	0.97
124	0.97
125	0.97
126	0.95
127	0.94
128	0.88
129	0.8
130	0.71
131	0.61
132	0.51
133	0.41
134	0.38
135	0.28
136	0.28
137	0.24
138	0.22
139	0.27
140	0.31
141	0.34
142	0.36
143	0.43
144	0.39
145	0.41
146	0.41
147	0.36
148	0.32
149	0.34
150	0.26
151	0.21
152	0.22
153	0.2
154	0.21
155	0.2
156	0.19
157	0.15
158	0.16
159	0.15
160	0.14
161	0.15
162	0.15
163	0.16
164	0.17
165	0.16
166	0.17
167	0.2
168	0.19
169	0.19
170	0.22
171	0.21
172	0.21
173	0.2
174	0.17
175	0.14
176	0.14
177	0.14
178	0.11
179	0.17
180	0.16
181	0.16
182	0.17
183	0.18
184	0.24
185	0.25
186	0.25
187	0.26
188	0.26
189	0.27
190	0.27
191	0.26
192	0.18
193	0.16
194	0.16
195	0.1
196	0.11
197	0.1
198	0.1
199	0.1
200	0.09
201	0.09
202	0.08
203	0.07
204	0.08
205	0.09
206	0.09
207	0.1
208	0.1
209	0.1
210	0.12
211	0.11
212	0.09
213	0.08
214	0.08
215	0.08
216	0.11
217	0.14
218	0.19
219	0.26
220	0.3
221	0.31
222	0.32
223	0.32
224	0.31
225	0.31
226	0.28
227	0.25
228	0.21
229	0.2
230	0.2
231	0.18
232	0.17
233	0.13
234	0.1
235	0.07
236	0.07
237	0.06
238	0.06
239	0.05
240	0.06
241	0.05
242	0.05
243	0.05
244	0.04
245	0.04
246	0.06
247	0.08
248	0.08
249	0.09
250	0.09
251	0.1
252	0.09
253	0.09
254	0.08
255	0.07
256	0.06
257	0.08
258	0.09
259	0.1
260	0.1
261	0.11
262	0.12
263	0.15
264	0.22
265	0.24
266	0.28
267	0.29
268	0.3
269	0.36
270	0.38
271	0.36
272	0.35
273	0.35
274	0.37
275	0.41
276	0.43
277	0.42
278	0.41
279	0.43
280	0.43
281	0.41
282	0.39
283	0.4
284	0.38
285	0.35
286	0.33
287	0.31
288	0.26
289	0.23
290	0.2
291	0.17
292	0.16
293	0.15
294	0.16
295	0.16
296	0.15
297	0.14
298	0.14
299	0.13
300	0.13
301	0.12
302	0.11
303	0.13
304	0.13
305	0.13
306	0.11
307	0.08
308	0.07
309	0.07
310	0.06
311	0.03
312	0.02
313	0.02
314	0.02
315	0.02
316	0.02
317	0.02
318	0.03
319	0.03
320	0.03
321	0.03
322	0.04
323	0.04
324	0.05
325	0.06
326	0.06
327	0.08
328	0.1
329	0.13
330	0.12
331	0.13
332	0.13
333	0.11
334	0.11
335	0.1
336	0.1
337	0.1
338	0.1
339	0.12
340	0.13
341	0.17
342	0.17
343	0.19
344	0.19
345	0.19
346	0.19
347	0.19
348	0.19
349	0.16
350	0.16
351	0.16
352	0.14
353	0.13
354	0.13
355	0.11
356	0.11
357	0.1
358	0.11
359	0.1
360	0.13
361	0.13
362	0.13
363	0.12
364	0.12
365	0.13
366	0.13
367	0.13
368	0.1
369	0.09
370	0.09
371	0.09
372	0.09
373	0.08
374	0.07
375	0.07
376	0.07
377	0.08
378	0.08
379	0.08
380	0.08
381	0.08
382	0.09
383	0.09
384	0.09
385	0.08
386	0.07
387	0.08
388	0.09
389	0.1
390	0.09
391	0.09
392	0.09
393	0.11
394	0.11
395	0.11
396	0.11
397	0.13
398	0.14
399	0.18
400	0.22
401	0.25
402	0.32
403	0.34
404	0.37
405	0.36
406	0.36
407	0.33
408	0.31
409	0.28
410	0.21
411	0.19
412	0.15
413	0.14
414	0.13
415	0.13
416	0.15
417	0.16
418	0.19
419	0.21
420	0.21
421	0.22
422	0.22
423	0.24
424	0.2
425	0.18
426	0.17
427	0.14
428	0.13
429	0.13
430	0.12
431	0.08
432	0.08
433	0.12
434	0.15
435	0.2
436	0.24
437	0.29
438	0.35
439	0.36
440	0.39
441	0.44
442	0.4
443	0.38
444	0.34
445	0.32
446	0.26
447	0.24
448	0.21
449	0.12
450	0.11
451	0.09
452	0.08
453	0.05
454	0.06
455	0.07
456	0.07
457	0.08
458	0.08
459	0.1
460	0.11
461	0.11
462	0.11
463	0.11
464	0.14
465	0.14
466	0.15
467	0.15
468	0.14
469	0.13
470	0.14
471	0.18
472	0.19
473	0.19
474	0.22
475	0.25
476	0.28
477	0.29
478	0.32
479	0.33
480	0.32
481	0.38
482	0.35
483	0.33
484	0.31
485	0.3
486	0.26
487	0.2
488	0.16
489	0.1
490	0.09
491	0.09
492	0.16
493	0.16
494	0.16
495	0.16
496	0.16
497	0.17
498	0.16
499	0.18
500	0.11
501	0.17
502	0.2
503	0.21
504	0.2
505	0.2
506	0.2
507	0.16
508	0.2
509	0.19
510	0.21
511	0.24
512	0.28
513	0.32
514	0.34
515	0.41
516	0.44
517	0.42
518	0.45
519	0.48
520	0.46
521	0.45
522	0.43
523	0.36
524	0.29
525	0.26
526	0.21
527	0.14
528	0.12
529	0.09
530	0.11
531	0.13
532	0.18
533	0.19
534	0.22
535	0.31
536	0.31
537	0.32
538	0.35
539	0.35
540	0.31
541	0.38
542	0.36
543	0.34
544	0.37
545	0.35
546	0.33
547	0.3
548	0.27
549	0.24
550	0.23
551	0.24
552	0.22
553	0.22
554	0.21
555	0.21
556	0.21
557	0.16
558	0.14
559	0.06
560	0.06
561	0.06
562	0.05
563	0.06
564	0.06
565	0.06
566	0.06
567	0.07
568	0.13
569	0.13
570	0.17
571	0.17
572	0.19
573	0.2
574	0.22
575	0.24
576	0.19
577	0.23
578	0.23
579	0.27
580	0.26
581	0.25
582	0.25
583	0.24
584	0.27
585	0.3
586	0.28
587	0.25
588	0.25
589	0.27
590	0.28
591	0.27
592	0.23
593	0.18
594	0.18
595	0.18
596	0.17
597	0.14
598	0.12
599	0.14
600	0.12
601	0.12
602	0.12
603	0.13
604	0.15
605	0.16
606	0.16
607	0.19
608	0.21
609	0.23
610	0.23
611	0.27
612	0.25
613	0.26
614	0.27
615	0.22
616	0.22
617	0.25
618	0.25

B6K8B9

3D AlphaFold-predicted Structure Viewer