Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3E559

Protein Details
Accession A0A2H3E559   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
82-123LDLRVKKTRAIRRRMTKHETSLKTLKQKKKEQNFPVRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
86-112VKKTRAIRRRMTKHETSLKTLKQKKKE
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLLDLKNELLTLRVQKIAGGSASKLTKINTVRKSIARVMTVMNQKARQNLREYYKDKKYLPLDLRVKKTRAIRRRMTKHETSLKTLKQKKKEQNFPVRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.53
9 0.5
10 0.47
11 0.46
12 0.38
13 0.33
14 0.28
15 0.25
16 0.16
17 0.15
18 0.17
19 0.17
20 0.17
21 0.16
22 0.16
23 0.16
24 0.16
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.23
46 0.26
47 0.28
48 0.26
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.28
55 0.28
56 0.31
57 0.35
58 0.4
59 0.43
60 0.44
61 0.49
62 0.52
63 0.49
64 0.51
65 0.48
66 0.48
67 0.49
68 0.51
69 0.53
70 0.54
71 0.61
72 0.6
73 0.59
74 0.55
75 0.6
76 0.61
77 0.61
78 0.63
79 0.65
80 0.7
81 0.78
82 0.83
83 0.82
84 0.78
85 0.78
86 0.79
87 0.73
88 0.7
89 0.68
90 0.66
91 0.68
92 0.71
93 0.71
94 0.7
95 0.77
96 0.8
97 0.83
98 0.87
99 0.87
100 0.89
101 0.91
102 0.88
103 0.87
104 0.81