Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K386

Protein Details
Accession B6K386   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
235-261MVENIATRKRRKLWRRKEDRFSYPYKEHydrophilic
NLS Segment(s)
PositionSequence
242-251RKRRKLWRRK
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0042645  C:mitochondrial nucleoid  
GO:0003677  F:DNA binding  
GO:0003697  F:single-stranded DNA binding  
GO:0036297  P:interstrand cross-link repair  
GO:0000002  P:mitochondrial genome maintenance  
GO:0000725  P:recombinational repair  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences MAILSNLFATAKCSLLNASRRAVFSGLKTPSYHFLTNPVFKDFARHSWFSTSTIKCNENQEAIQNEKELKEYLVGEENGEELPGVPEEGTNWQTSFAGLSEKPFSKEISDVLLTPLSLQDIEIKPDGILYLPEIKYRRILNRAFGPGGWGLAPRGKTTVTPKSVSREYALVCHGRLVSVARGEQVYFDPSNIPTATEGCKSNALMRCCKDLGIASELWDPRFIQAFKKQHCSEVMVENIATRKRRKLWRRKEDRFSYPYKEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.22
3 0.29
4 0.3
5 0.33
6 0.36
7 0.37
8 0.38
9 0.38
10 0.33
11 0.29
12 0.34
13 0.33
14 0.31
15 0.32
16 0.32
17 0.36
18 0.39
19 0.37
20 0.28
21 0.33
22 0.38
23 0.43
24 0.43
25 0.4
26 0.35
27 0.34
28 0.39
29 0.35
30 0.35
31 0.36
32 0.35
33 0.34
34 0.38
35 0.4
36 0.38
37 0.43
38 0.37
39 0.36
40 0.4
41 0.4
42 0.37
43 0.41
44 0.41
45 0.35
46 0.34
47 0.33
48 0.32
49 0.34
50 0.32
51 0.28
52 0.26
53 0.23
54 0.24
55 0.19
56 0.15
57 0.14
58 0.13
59 0.14
60 0.17
61 0.17
62 0.15
63 0.15
64 0.15
65 0.12
66 0.12
67 0.1
68 0.05
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.09
76 0.1
77 0.1
78 0.1
79 0.11
80 0.11
81 0.11
82 0.11
83 0.08
84 0.09
85 0.09
86 0.11
87 0.14
88 0.15
89 0.17
90 0.17
91 0.18
92 0.16
93 0.16
94 0.15
95 0.15
96 0.14
97 0.12
98 0.13
99 0.12
100 0.11
101 0.1
102 0.09
103 0.06
104 0.05
105 0.05
106 0.09
107 0.09
108 0.11
109 0.12
110 0.12
111 0.11
112 0.11
113 0.11
114 0.06
115 0.06
116 0.05
117 0.1
118 0.1
119 0.14
120 0.15
121 0.15
122 0.19
123 0.22
124 0.25
125 0.26
126 0.27
127 0.29
128 0.33
129 0.36
130 0.33
131 0.3
132 0.27
133 0.21
134 0.2
135 0.15
136 0.1
137 0.07
138 0.1
139 0.1
140 0.09
141 0.1
142 0.1
143 0.12
144 0.18
145 0.26
146 0.27
147 0.29
148 0.3
149 0.35
150 0.37
151 0.36
152 0.31
153 0.26
154 0.22
155 0.23
156 0.24
157 0.2
158 0.17
159 0.18
160 0.16
161 0.13
162 0.13
163 0.13
164 0.12
165 0.12
166 0.12
167 0.12
168 0.12
169 0.12
170 0.13
171 0.12
172 0.14
173 0.12
174 0.12
175 0.13
176 0.13
177 0.16
178 0.15
179 0.15
180 0.11
181 0.13
182 0.16
183 0.17
184 0.18
185 0.16
186 0.19
187 0.19
188 0.25
189 0.29
190 0.31
191 0.35
192 0.36
193 0.4
194 0.38
195 0.37
196 0.32
197 0.28
198 0.27
199 0.24
200 0.22
201 0.19
202 0.24
203 0.25
204 0.24
205 0.23
206 0.2
207 0.18
208 0.24
209 0.23
210 0.24
211 0.32
212 0.41
213 0.45
214 0.55
215 0.54
216 0.52
217 0.54
218 0.52
219 0.46
220 0.43
221 0.41
222 0.33
223 0.31
224 0.29
225 0.31
226 0.31
227 0.34
228 0.32
229 0.37
230 0.44
231 0.55
232 0.64
233 0.71
234 0.77
235 0.83
236 0.9
237 0.92
238 0.94
239 0.93
240 0.92
241 0.87
242 0.83