Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K458

Protein Details
Accession B6K458    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
102-122AVQKAQSSTKSQKKKKRGKRKBasic
NLS Segment(s)
PositionSequence
111-122KSQKKKKRGKRK
Subcellular Location(s) cyto 13, cyto_nucl 12.333, nucl 9.5, mito_nucl 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR009018  Signal_recog_particle_SRP9/14  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MVVFRTLNEFLEETKLLLDAYPSTTKLVIRYRIHEADAYIFVKAYEIANGICLKYRTDKLAEMTHLIQMQGKFAFVMNGKDIPVEEEAKPQEVQAQVTEKPAVQKAQSSTKSQKKKKRGKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.12
4 0.11
5 0.11
6 0.08
7 0.12
8 0.14
9 0.14
10 0.15
11 0.17
12 0.17
13 0.22
14 0.27
15 0.31
16 0.32
17 0.36
18 0.41
19 0.42
20 0.43
21 0.38
22 0.32
23 0.26
24 0.26
25 0.23
26 0.15
27 0.14
28 0.12
29 0.11
30 0.11
31 0.08
32 0.06
33 0.06
34 0.06
35 0.08
36 0.08
37 0.08
38 0.1
39 0.1
40 0.1
41 0.13
42 0.15
43 0.15
44 0.17
45 0.18
46 0.19
47 0.22
48 0.21
49 0.2
50 0.19
51 0.18
52 0.17
53 0.15
54 0.15
55 0.12
56 0.13
57 0.1
58 0.1
59 0.08
60 0.08
61 0.1
62 0.09
63 0.11
64 0.11
65 0.12
66 0.12
67 0.12
68 0.12
69 0.11
70 0.13
71 0.14
72 0.12
73 0.17
74 0.18
75 0.2
76 0.2
77 0.18
78 0.2
79 0.19
80 0.19
81 0.17
82 0.2
83 0.19
84 0.21
85 0.22
86 0.19
87 0.21
88 0.24
89 0.23
90 0.21
91 0.25
92 0.27
93 0.37
94 0.4
95 0.44
96 0.51
97 0.58
98 0.67
99 0.72
100 0.78
101 0.79
102 0.86