Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K335

Protein Details
Accession B6K335    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
31-56YHVLLKRKEQLKQRKANPKEIQKVQSHydrophilic
NLS Segment(s)
PositionSequence
14-47EKPGALKKLKGNKLIRHYHVLLKRKEQLKQRKAN
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR021867  Bmt2/SAMTOR  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0016433  F:rRNA (adenine) methyltransferase activity  
Pfam View protein in Pfam  
PF11968  Bmt2  
Amino Acid Sequences MRPVPVRLRTERQEKPGALKKLKGNKLIRHYHVLLKRKEQLKQRKANPKEIQKVQSELDMLGIDAYQKASQNGQNKRRGGDSSVILVEYVKSQKYPKTVYPIDLLEIGCVSIDNKCSTSKLFRVDRIDLHSTHPLIKQQDILERTPSEGMYGCISCSLVLNFAPPETRGDILLHCTRLLKPPTEQMKSLFFLVLPAPCVLNSRYMSLETISKMMEDLGLFTVYTKTTAKIVYLIYEYRKEPKSVIVWKKKELFKGATRNNFFIPLNTTEATRRPVNKDEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.68
4 0.7
5 0.65
6 0.64
7 0.66
8 0.68
9 0.73
10 0.73
11 0.72
12 0.71
13 0.76
14 0.79
15 0.75
16 0.72
17 0.68
18 0.67
19 0.66
20 0.67
21 0.62
22 0.61
23 0.64
24 0.62
25 0.66
26 0.67
27 0.7
28 0.72
29 0.76
30 0.78
31 0.81
32 0.81
33 0.85
34 0.84
35 0.84
36 0.83
37 0.81
38 0.77
39 0.69
40 0.66
41 0.56
42 0.5
43 0.4
44 0.3
45 0.23
46 0.17
47 0.14
48 0.1
49 0.09
50 0.07
51 0.06
52 0.07
53 0.07
54 0.08
55 0.09
56 0.13
57 0.18
58 0.27
59 0.36
60 0.44
61 0.51
62 0.52
63 0.52
64 0.52
65 0.49
66 0.44
67 0.39
68 0.32
69 0.27
70 0.25
71 0.23
72 0.2
73 0.18
74 0.14
75 0.12
76 0.13
77 0.1
78 0.11
79 0.13
80 0.17
81 0.22
82 0.26
83 0.27
84 0.34
85 0.35
86 0.36
87 0.37
88 0.34
89 0.3
90 0.28
91 0.24
92 0.15
93 0.13
94 0.11
95 0.07
96 0.07
97 0.06
98 0.05
99 0.07
100 0.08
101 0.09
102 0.1
103 0.11
104 0.13
105 0.17
106 0.19
107 0.25
108 0.28
109 0.31
110 0.35
111 0.37
112 0.37
113 0.38
114 0.37
115 0.31
116 0.3
117 0.28
118 0.24
119 0.24
120 0.23
121 0.21
122 0.2
123 0.19
124 0.19
125 0.17
126 0.21
127 0.22
128 0.22
129 0.21
130 0.19
131 0.2
132 0.18
133 0.16
134 0.12
135 0.1
136 0.1
137 0.09
138 0.09
139 0.08
140 0.07
141 0.07
142 0.07
143 0.07
144 0.06
145 0.05
146 0.05
147 0.06
148 0.06
149 0.07
150 0.07
151 0.07
152 0.09
153 0.1
154 0.1
155 0.1
156 0.11
157 0.11
158 0.16
159 0.18
160 0.16
161 0.15
162 0.16
163 0.16
164 0.23
165 0.25
166 0.22
167 0.22
168 0.3
169 0.38
170 0.39
171 0.39
172 0.35
173 0.36
174 0.35
175 0.34
176 0.26
177 0.17
178 0.16
179 0.16
180 0.14
181 0.11
182 0.1
183 0.1
184 0.09
185 0.12
186 0.11
187 0.16
188 0.16
189 0.17
190 0.18
191 0.18
192 0.19
193 0.18
194 0.2
195 0.15
196 0.15
197 0.13
198 0.12
199 0.11
200 0.1
201 0.1
202 0.07
203 0.08
204 0.08
205 0.08
206 0.08
207 0.08
208 0.1
209 0.09
210 0.11
211 0.11
212 0.1
213 0.12
214 0.13
215 0.13
216 0.15
217 0.15
218 0.15
219 0.18
220 0.2
221 0.21
222 0.24
223 0.26
224 0.3
225 0.32
226 0.31
227 0.3
228 0.33
229 0.38
230 0.44
231 0.53
232 0.57
233 0.59
234 0.66
235 0.73
236 0.72
237 0.7
238 0.67
239 0.64
240 0.62
241 0.68
242 0.7
243 0.71
244 0.71
245 0.68
246 0.62
247 0.59
248 0.5
249 0.42
250 0.38
251 0.31
252 0.31
253 0.28
254 0.28
255 0.27
256 0.31
257 0.33
258 0.35
259 0.38
260 0.39