Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DFE7

Protein Details
Accession A0A2H3DFE7   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-26PRNVATKSKKIQSTKDREVNHydrophilic
NLS Segment(s)
PositionSequence
475-482GQKRARRR
Subcellular Location(s) mito 11, nucl 10.5, cyto_mito 8.833, cyto_nucl 8.166, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014886  La_xRRM  
IPR045537  Lar7_xRRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0070034  F:telomerase RNA binding  
GO:1904868  P:telomerase catalytic core complex assembly  
Pfam View protein in Pfam  
PF19977  xRRM  
PROSITE View protein in PROSITE  
PS51939  XRRM  
Amino Acid Sequences MSLPFIPRNVATKSKKIQSTKDREVNISSACSPRIPLSIAKGKEQDKPDIDEPAVLNKSSFSDKEYASLISLALSDFALFSDPDLRRKIDEGEDGFVSLLHILKHALHGILISESETAAAKALRSEATDSIEVRMVFSGPSWSAQGSFKNKGMFEVRRKDPQNTFTRENWKERTLYLENIPVQYASLPGVFHLTQVLLTKTTDTIASFNRIQSISIPPHHLDKPGDIPKCKGFALLTLLDVEDVQQLLREWPWTLVVCATDVKPAISEFQEATKFGFRALSKTRWDEMKDEYLAYRARLVKEIVSYEDEMAAHAATKRRRSPSPAISSIPDTVETTLTSSSLFPPKCLVFVRNLHCETNKTTLRALFSKAFTSLPDGLDYVDFTKGMDSCYLRVATPEHARALTDYFTQAKMAQTNGLDSEGSRDAETKAITMETMGGRREEIYWEKVPPKVRHEAVDKALRLLEPETTRKDEGGQKRARRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.67
3 0.69
4 0.74
5 0.75
6 0.79
7 0.8
8 0.8
9 0.75
10 0.7
11 0.67
12 0.61
13 0.53
14 0.46
15 0.39
16 0.34
17 0.31
18 0.28
19 0.26
20 0.24
21 0.25
22 0.23
23 0.23
24 0.28
25 0.36
26 0.37
27 0.41
28 0.46
29 0.46
30 0.51
31 0.52
32 0.52
33 0.47
34 0.52
35 0.49
36 0.47
37 0.44
38 0.4
39 0.37
40 0.36
41 0.35
42 0.28
43 0.25
44 0.21
45 0.23
46 0.24
47 0.24
48 0.19
49 0.22
50 0.22
51 0.24
52 0.25
53 0.23
54 0.2
55 0.19
56 0.15
57 0.11
58 0.11
59 0.09
60 0.08
61 0.07
62 0.06
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.15
69 0.16
70 0.21
71 0.24
72 0.26
73 0.26
74 0.29
75 0.32
76 0.28
77 0.34
78 0.31
79 0.31
80 0.3
81 0.28
82 0.26
83 0.22
84 0.17
85 0.11
86 0.1
87 0.07
88 0.07
89 0.08
90 0.08
91 0.1
92 0.11
93 0.1
94 0.09
95 0.09
96 0.09
97 0.09
98 0.08
99 0.07
100 0.06
101 0.06
102 0.07
103 0.07
104 0.06
105 0.07
106 0.07
107 0.06
108 0.07
109 0.09
110 0.09
111 0.1
112 0.13
113 0.13
114 0.16
115 0.18
116 0.18
117 0.18
118 0.2
119 0.18
120 0.16
121 0.15
122 0.12
123 0.1
124 0.1
125 0.11
126 0.08
127 0.09
128 0.1
129 0.09
130 0.11
131 0.13
132 0.19
133 0.23
134 0.26
135 0.28
136 0.31
137 0.3
138 0.32
139 0.37
140 0.38
141 0.41
142 0.46
143 0.48
144 0.53
145 0.56
146 0.59
147 0.58
148 0.59
149 0.59
150 0.57
151 0.58
152 0.55
153 0.62
154 0.61
155 0.62
156 0.57
157 0.51
158 0.46
159 0.41
160 0.43
161 0.36
162 0.33
163 0.29
164 0.3
165 0.28
166 0.28
167 0.28
168 0.2
169 0.17
170 0.14
171 0.12
172 0.07
173 0.07
174 0.06
175 0.06
176 0.09
177 0.09
178 0.09
179 0.09
180 0.08
181 0.08
182 0.09
183 0.1
184 0.08
185 0.08
186 0.09
187 0.08
188 0.09
189 0.08
190 0.08
191 0.09
192 0.1
193 0.14
194 0.14
195 0.14
196 0.16
197 0.16
198 0.16
199 0.15
200 0.19
201 0.19
202 0.2
203 0.22
204 0.2
205 0.24
206 0.25
207 0.26
208 0.21
209 0.2
210 0.26
211 0.3
212 0.33
213 0.3
214 0.31
215 0.31
216 0.32
217 0.3
218 0.23
219 0.16
220 0.14
221 0.17
222 0.15
223 0.13
224 0.11
225 0.11
226 0.1
227 0.1
228 0.09
229 0.05
230 0.04
231 0.04
232 0.04
233 0.04
234 0.05
235 0.05
236 0.06
237 0.06
238 0.06
239 0.08
240 0.08
241 0.08
242 0.08
243 0.08
244 0.08
245 0.09
246 0.09
247 0.09
248 0.09
249 0.08
250 0.08
251 0.08
252 0.09
253 0.08
254 0.09
255 0.08
256 0.11
257 0.12
258 0.12
259 0.14
260 0.15
261 0.14
262 0.13
263 0.17
264 0.14
265 0.19
266 0.24
267 0.27
268 0.28
269 0.32
270 0.34
271 0.33
272 0.35
273 0.32
274 0.31
275 0.31
276 0.28
277 0.25
278 0.23
279 0.23
280 0.22
281 0.2
282 0.2
283 0.18
284 0.18
285 0.2
286 0.21
287 0.19
288 0.2
289 0.21
290 0.18
291 0.17
292 0.17
293 0.15
294 0.15
295 0.13
296 0.12
297 0.11
298 0.08
299 0.07
300 0.08
301 0.13
302 0.17
303 0.23
304 0.29
305 0.34
306 0.38
307 0.44
308 0.51
309 0.56
310 0.6
311 0.59
312 0.55
313 0.51
314 0.51
315 0.44
316 0.36
317 0.27
318 0.19
319 0.16
320 0.14
321 0.12
322 0.11
323 0.1
324 0.09
325 0.09
326 0.09
327 0.11
328 0.18
329 0.18
330 0.17
331 0.21
332 0.21
333 0.23
334 0.25
335 0.23
336 0.22
337 0.3
338 0.35
339 0.39
340 0.42
341 0.41
342 0.41
343 0.42
344 0.39
345 0.4
346 0.38
347 0.32
348 0.32
349 0.32
350 0.35
351 0.35
352 0.35
353 0.31
354 0.29
355 0.29
356 0.27
357 0.25
358 0.21
359 0.25
360 0.23
361 0.19
362 0.18
363 0.17
364 0.16
365 0.16
366 0.16
367 0.12
368 0.1
369 0.09
370 0.08
371 0.1
372 0.1
373 0.11
374 0.14
375 0.14
376 0.15
377 0.19
378 0.19
379 0.17
380 0.19
381 0.19
382 0.22
383 0.27
384 0.29
385 0.28
386 0.27
387 0.28
388 0.27
389 0.28
390 0.23
391 0.18
392 0.18
393 0.17
394 0.18
395 0.18
396 0.19
397 0.19
398 0.19
399 0.19
400 0.2
401 0.18
402 0.2
403 0.19
404 0.19
405 0.16
406 0.14
407 0.18
408 0.17
409 0.17
410 0.16
411 0.16
412 0.16
413 0.19
414 0.19
415 0.15
416 0.14
417 0.13
418 0.12
419 0.11
420 0.14
421 0.14
422 0.17
423 0.18
424 0.17
425 0.17
426 0.18
427 0.19
428 0.21
429 0.23
430 0.27
431 0.28
432 0.34
433 0.37
434 0.4
435 0.49
436 0.49
437 0.51
438 0.54
439 0.54
440 0.55
441 0.58
442 0.61
443 0.59
444 0.62
445 0.56
446 0.49
447 0.48
448 0.41
449 0.37
450 0.31
451 0.3
452 0.27
453 0.32
454 0.36
455 0.4
456 0.41
457 0.4
458 0.44
459 0.47
460 0.51
461 0.55
462 0.58