FuNGI

A0A2H3DFE7

Protein Details

Accession

A0A2H3DFE7

Localization Confidence

Medium

Confidence Score

10.4

NoLS Segment(s)

Position	Sequence	Protein Nature
7-26	PRNVATKSKKIQSTKDREVN	Hydrophilic

NLS Segment(s)

Position	Sequence
475-482	GQKRARRR

Subcellular Location(s)

mito 11, nucl 10.5, cyto_mito 8.833, cyto_nucl 8.166, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR014886 La_xRRM IPR045537 Lar7_xRRM IPR012677 Nucleotide-bd_a/b_plait_sf
Gene Ontology	GO:1990904 C:ribonucleoprotein complex GO:0070034 F:telomerase RNA binding GO:1904868 P:telomerase catalytic core complex assembly
Pfam	View protein in Pfam PF19977 xRRM
PROSITE	View protein in PROSITE PS51939 XRRM

Amino Acid Sequences

MSLPFIPRNVATKSKKIQSTKDREVNISSACSPRIPLSIAKGKEQDKPDIDEPAVLNKSSFSDKEYASLISLALSDFALFSDPDLRRKIDEGEDGFVSLLHILKHALHGILISESETAAAKALRSEATDSIEVRMVFSGPSWSAQGSFKNKGMFEVRRKDPQNTFTRENWKERTLYLENIPVQYASLPGVFHLTQVLLTKTTDTIASFNRIQSISIPPHHLDKPGDIPKCKGFALLTLLDVEDVQQLLREWPWTLVVCATDVKPAISEFQEATKFGFRALSKTRWDEMKDEYLAYRARLVKEIVSYEDEMAAHAATKRRRSPSPAISSIPDTVETTLTSSSLFPPKCLVFVRNLHCETNKTTLRALFSKAFTSLPDGLDYVDFTKGMDSCYLRVATPEHARALTDYFTQAKMAQTNGLDSEGSRDAETKAITMETMGGRREEIYWEKVPPKVRHEAVDKALRLLEPETTRKDEGGQKRARRR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.61
2	0.67
3	0.69
4	0.74
5	0.75
6	0.79
7	0.8
8	0.8
9	0.75
10	0.7
11	0.67
12	0.61
13	0.53
14	0.46
15	0.39
16	0.34
17	0.31
18	0.28
19	0.26
20	0.24
21	0.25
22	0.23
23	0.23
24	0.28
25	0.36
26	0.37
27	0.41
28	0.46
29	0.46
30	0.51
31	0.52
32	0.52
33	0.47
34	0.52
35	0.49
36	0.47
37	0.44
38	0.4
39	0.37
40	0.36
41	0.35
42	0.28
43	0.25
44	0.21
45	0.23
46	0.24
47	0.24
48	0.19
49	0.22
50	0.22
51	0.24
52	0.25
53	0.23
54	0.2
55	0.19
56	0.15
57	0.11
58	0.11
59	0.09
60	0.08
61	0.07
62	0.06
63	0.05
64	0.05
65	0.06
66	0.06
67	0.07
68	0.15
69	0.16
70	0.21
71	0.24
72	0.26
73	0.26
74	0.29
75	0.32
76	0.28
77	0.34
78	0.31
79	0.31
80	0.3
81	0.28
82	0.26
83	0.22
84	0.17
85	0.11
86	0.1
87	0.07
88	0.07
89	0.08
90	0.08
91	0.1
92	0.11
93	0.1
94	0.09
95	0.09
96	0.09
97	0.09
98	0.08
99	0.07
100	0.06
101	0.06
102	0.07
103	0.07
104	0.06
105	0.07
106	0.07
107	0.06
108	0.07
109	0.09
110	0.09
111	0.1
112	0.13
113	0.13
114	0.16
115	0.18
116	0.18
117	0.18
118	0.2
119	0.18
120	0.16
121	0.15
122	0.12
123	0.1
124	0.1
125	0.11
126	0.08
127	0.09
128	0.1
129	0.09
130	0.11
131	0.13
132	0.19
133	0.23
134	0.26
135	0.28
136	0.31
137	0.3
138	0.32
139	0.37
140	0.38
141	0.41
142	0.46
143	0.48
144	0.53
145	0.56
146	0.59
147	0.58
148	0.59
149	0.59
150	0.57
151	0.58
152	0.55
153	0.62
154	0.61
155	0.62
156	0.57
157	0.51
158	0.46
159	0.41
160	0.43
161	0.36
162	0.33
163	0.29
164	0.3
165	0.28
166	0.28
167	0.28
168	0.2
169	0.17
170	0.14
171	0.12
172	0.07
173	0.07
174	0.06
175	0.06
176	0.09
177	0.09
178	0.09
179	0.09
180	0.08
181	0.08
182	0.09
183	0.1
184	0.08
185	0.08
186	0.09
187	0.08
188	0.09
189	0.08
190	0.08
191	0.09
192	0.1
193	0.14
194	0.14
195	0.14
196	0.16
197	0.16
198	0.16
199	0.15
200	0.19
201	0.19
202	0.2
203	0.22
204	0.2
205	0.24
206	0.25
207	0.26
208	0.21
209	0.2
210	0.26
211	0.3
212	0.33
213	0.3
214	0.31
215	0.31
216	0.32
217	0.3
218	0.23
219	0.16
220	0.14
221	0.17
222	0.15
223	0.13
224	0.11
225	0.11
226	0.1
227	0.1
228	0.09
229	0.05
230	0.04
231	0.04
232	0.04
233	0.04
234	0.05
235	0.05
236	0.06
237	0.06
238	0.06
239	0.08
240	0.08
241	0.08
242	0.08
243	0.08
244	0.08
245	0.09
246	0.09
247	0.09
248	0.09
249	0.08
250	0.08
251	0.08
252	0.09
253	0.08
254	0.09
255	0.08
256	0.11
257	0.12
258	0.12
259	0.14
260	0.15
261	0.14
262	0.13
263	0.17
264	0.14
265	0.19
266	0.24
267	0.27
268	0.28
269	0.32
270	0.34
271	0.33
272	0.35
273	0.32
274	0.31
275	0.31
276	0.28
277	0.25
278	0.23
279	0.23
280	0.22
281	0.2
282	0.2
283	0.18
284	0.18
285	0.2
286	0.21
287	0.19
288	0.2
289	0.21
290	0.18
291	0.17
292	0.17
293	0.15
294	0.15
295	0.13
296	0.12
297	0.11
298	0.08
299	0.07
300	0.08
301	0.13
302	0.17
303	0.23
304	0.29
305	0.34
306	0.38
307	0.44
308	0.51
309	0.56
310	0.6
311	0.59
312	0.55
313	0.51
314	0.51
315	0.44
316	0.36
317	0.27
318	0.19
319	0.16
320	0.14
321	0.12
322	0.11
323	0.1
324	0.09
325	0.09
326	0.09
327	0.11
328	0.18
329	0.18
330	0.17
331	0.21
332	0.21
333	0.23
334	0.25
335	0.23
336	0.22
337	0.3
338	0.35
339	0.39
340	0.42
341	0.41
342	0.41
343	0.42
344	0.39
345	0.4
346	0.38
347	0.32
348	0.32
349	0.32
350	0.35
351	0.35
352	0.35
353	0.31
354	0.29
355	0.29
356	0.27
357	0.25
358	0.21
359	0.25
360	0.23
361	0.19
362	0.18
363	0.17
364	0.16
365	0.16
366	0.16
367	0.12
368	0.1
369	0.09
370	0.08
371	0.1
372	0.1
373	0.11
374	0.14
375	0.14
376	0.15
377	0.19
378	0.19
379	0.17
380	0.19
381	0.19
382	0.22
383	0.27
384	0.29
385	0.28
386	0.27
387	0.28
388	0.27
389	0.28
390	0.23
391	0.18
392	0.18
393	0.17
394	0.18
395	0.18
396	0.19
397	0.19
398	0.19
399	0.19
400	0.2
401	0.18
402	0.2
403	0.19
404	0.19
405	0.16
406	0.14
407	0.18
408	0.17
409	0.17
410	0.16
411	0.16
412	0.16
413	0.19
414	0.19
415	0.15
416	0.14
417	0.13
418	0.12
419	0.11
420	0.14
421	0.14
422	0.17
423	0.18
424	0.17
425	0.17
426	0.18
427	0.19
428	0.21
429	0.23
430	0.27
431	0.28
432	0.34
433	0.37
434	0.4
435	0.49
436	0.49
437	0.51
438	0.54
439	0.54
440	0.55
441	0.58
442	0.61
443	0.59
444	0.62
445	0.56
446	0.49
447	0.48
448	0.41
449	0.37
450	0.31
451	0.3
452	0.27
453	0.32
454	0.36
455	0.4
456	0.41
457	0.4
458	0.44
459	0.47
460	0.51
461	0.55
462	0.58

A0A2H3DFE7

3D AlphaFold-predicted Structure Viewer