Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DMT2

Protein Details
Accession A0A2H3DMT2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-67SDAPKCTKHIPPKRTKPKKNPKTHHANAKFSRBasic
NLS Segment(s)
PositionSequence
45-69IPPKRTKPKKNPKTHHANAKFSRPP
Subcellular Location(s) mito 17, nucl 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MKTCESTTYRTFSKIHACGLPVVLSWEVNHNNGLISDAPKCTKHIPPKRTKPKKNPKTHHANAKFSRPPGIKPGTTPVTSWTSVPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.33
4 0.33
5 0.3
6 0.3
7 0.26
8 0.17
9 0.17
10 0.13
11 0.11
12 0.1
13 0.14
14 0.15
15 0.15
16 0.15
17 0.13
18 0.12
19 0.12
20 0.13
21 0.09
22 0.09
23 0.09
24 0.1
25 0.12
26 0.12
27 0.14
28 0.16
29 0.22
30 0.32
31 0.4
32 0.48
33 0.57
34 0.68
35 0.77
36 0.85
37 0.89
38 0.89
39 0.92
40 0.93
41 0.93
42 0.91
43 0.89
44 0.89
45 0.86
46 0.86
47 0.82
48 0.82
49 0.74
50 0.75
51 0.7
52 0.6
53 0.62
54 0.53
55 0.47
56 0.46
57 0.49
58 0.41
59 0.39
60 0.46
61 0.42
62 0.41
63 0.39
64 0.35
65 0.34
66 0.33