Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3EFM7

Protein Details
Accession A0A2H3EFM7    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-69MKAAREYKRLHARRKKQPGGFBasic
NLS Segment(s)
PositionSequence
40-68KLRSKGMREMKAAREYKRLHARRKKQPGG
77-77K
94-96RHR
101-101R
104-155GHAPQRRHTTGVARTPGRSKPPVTAPGGRRSTQGRGQATGARRVQPKRRVTR
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
Amino Acid Sequences MKIEWAADFHRDGSRRRHPIPNTMHGWLAKMRGTIIGDEKLRSKGMREMKAAREYKRLHARRKKQPGGFLANLFGRKSSPSRTSSGTRGQPHLRHRVSAHRLVGHAPQRRHTTGVARTPGRSKPPVTAPGGRRSTQGRGQATGARRVQPKRRVTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.56
4 0.63
5 0.61
6 0.67
7 0.71
8 0.7
9 0.64
10 0.58
11 0.56
12 0.46
13 0.45
14 0.37
15 0.31
16 0.24
17 0.2
18 0.18
19 0.17
20 0.18
21 0.18
22 0.19
23 0.21
24 0.2
25 0.21
26 0.23
27 0.22
28 0.23
29 0.21
30 0.2
31 0.23
32 0.31
33 0.35
34 0.38
35 0.42
36 0.46
37 0.55
38 0.57
39 0.52
40 0.52
41 0.48
42 0.52
43 0.57
44 0.59
45 0.6
46 0.66
47 0.73
48 0.76
49 0.84
50 0.84
51 0.77
52 0.77
53 0.72
54 0.7
55 0.62
56 0.51
57 0.43
58 0.36
59 0.33
60 0.26
61 0.2
62 0.13
63 0.12
64 0.13
65 0.15
66 0.19
67 0.2
68 0.23
69 0.27
70 0.29
71 0.32
72 0.37
73 0.39
74 0.37
75 0.39
76 0.42
77 0.44
78 0.47
79 0.53
80 0.47
81 0.43
82 0.42
83 0.48
84 0.48
85 0.48
86 0.45
87 0.37
88 0.36
89 0.36
90 0.4
91 0.38
92 0.39
93 0.34
94 0.37
95 0.41
96 0.42
97 0.43
98 0.39
99 0.38
100 0.39
101 0.45
102 0.46
103 0.42
104 0.43
105 0.45
106 0.48
107 0.47
108 0.44
109 0.38
110 0.37
111 0.42
112 0.47
113 0.48
114 0.52
115 0.5
116 0.55
117 0.58
118 0.53
119 0.49
120 0.47
121 0.48
122 0.46
123 0.5
124 0.43
125 0.41
126 0.43
127 0.46
128 0.46
129 0.48
130 0.46
131 0.44
132 0.48
133 0.54
134 0.61
135 0.64